DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Prss2

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_033456.1 Gene:Prss2 / 22072 MGIID:102759 Length:246 Species:Mus musculus


Alignment Length:266 Identity:80/266 - (30%)
Similarity:117/266 - (43%) Gaps:50/266 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALI--GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDP 164
            ||||........|:...:  |.|           .||||:::.::|::||||.:.          
Mouse    24 IVGGYTCRESSVPYQVSLNAGYH-----------FCGGSLINDQWVVSAAHCYKY---------- 67

  Fly   165 NFDSPKFVVRLGELDYNSTT-DDALVQDFRVVNYVVHPGYD--TEDEEQGFKNDIALVELDRKAE 226
                 :..|||||.:.|... ::..|...:::.   ||.|:  |.|      |||.|::|.....
Mouse    68 -----RIQVRLGEHNINVLEGNEQFVDSAKIIR---HPNYNSWTLD------NDIMLIKLASPVT 118

  Fly   227 FNDHVAAVCLPPDSGNDVQQVTAAGWGFT-ADGVKSSHLLK-VNLQRFSDEVCQKRLRFSIDTRT 289
            .|..||:|.||........|...:|||.| ::||.:..||: |:........|:......| |..
Mouse   119 LNARVASVPLPSSCAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLPQADCEASYPGDI-TNN 182

  Fly   290 QFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIE 354
            ..|.|.:....|:|.||||||:.       |..::.||||:|..|.....|.|||||..|.|||:
Mouse   183 MICVGFLEGGKDSCQGDSGGPVV-------CNGELQGIVSWGYGCAQPDAPGVYTKVCNYVDWIQ 240

  Fly   355 SIVWGN 360
            :.:..|
Mouse   241 NTIADN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 79/260 (30%)
Tryp_SPc 102..353 CDD:214473 77/257 (30%)
Prss2NP_033456.1 Tryp_SPc 23..239 CDD:214473 77/257 (30%)
Tryp_SPc 24..242 CDD:238113 79/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.