DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and F11

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_005262878.1 Gene:F11 / 2160 HGNCID:3529 Length:626 Species:Homo sapiens


Alignment Length:273 Identity:86/273 - (31%)
Similarity:128/273 - (46%) Gaps:33/273 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 CKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAH 150
            ||..||..:..:  |.|||||.:...|:|:...:.|..|.:...     ||||::..:::|||||
Human   375 CKMDNECTTKIK--PRIVGGTASVRGEWPWQVTLHTTSPTQRHL-----CGGSIIGNQWILTAAH 432

  Fly   151 CLETDESKAERLDPNFDSPKFV-VRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKN 214
            |..           ..:|||.: |..|.|:.:...:|  ...|.|...::|..|  :..|.|:  
Human   433 CFY-----------GVESPKILRVYSGILNQSEIKED--TSFFGVQEIIIHDQY--KMAESGY-- 480

  Fly   215 DIALVELDRKAEFNDHVAAVCLPPDSGNDV--QQVTAAGWGF--TADGVKSSHLLKVNLQRFSDE 275
            ||||::|:....:.|....:|||.....:|  ......|||:  ..|.:::: |.|..:...::|
Human   481 DIALLKLETTVNYTDSQRPICLPSKGDRNVIYTDCWVTGWGYRKLRDKIQNT-LQKAKIPLVTNE 544

  Fly   276 VCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLP 340
            .||||.|....|....|||......|.|.||||||:..:|..   :..::||.|:|..|..:..|
Human   545 ECQKRYRGHKITHKMICAGYREGGKDACKGDSGGPLSCKHNE---VWHLVGITSWGEGCAQRERP 606

  Fly   341 SVYTKVHLYTDWI 353
            .|||.|..|.|||
Human   607 GVYTNVVEYVDWI 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 81/257 (32%)
Tryp_SPc 102..353 CDD:214473 79/255 (31%)
F11XP_005262878.1 APPLE 20..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519
APPLE 291..375 CDD:128519 86/273 (32%)
Tryp_SPc 388..619 CDD:214473 79/256 (31%)
Tryp_SPc 389..619 CDD:238113 79/255 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.