DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and F10

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_000495.1 Gene:F10 / 2159 HGNCID:3528 Length:488 Species:Homo sapiens


Alignment Length:407 Identity:102/407 - (25%)
Similarity:156/407 - (38%) Gaps:107/407 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TEYCDNGTGECKE-LTPSDCPVI---------FYNQHLIGAEVKYCDEF-----NDIVC------ 63
            |..|.| .|:||: |....|..:         .:.:.|...:...||:|     |.:||      
Human    92 TSPCQN-QGKCKDGLGEYTCTCLEGFEGKNCELFTRKLCSLDNGDCDQFCHEEQNSVVCSCARGY 155

  Fly    64 --------C----PIPLDHQNLKPAEQT----------RPFEKQCKQYNEVRSACQSTPF----- 101
                    |    |.|...|.|:..:::          .|.....|.|:.........||     
Human   156 TLADNGKACIPTGPYPCGKQTLERRKRSVAQATSSSGEAPDSITWKPYDAADLDPTENPFDLLDF 220

  Fly   102 --------------IVGGTKASGKEFPFMALIGTHRPNKSKSDINWD----CGGSVVHPKFVLTA 148
                          ||||.:....|.|:.||:           ||.:    |||:::...::|||
Human   221 NQTQPERGDNNLTRIVGGQECKDGECPWQALL-----------INEENEGFCGGTILSEFYILTA 274

  Fly   149 AHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFK 213
            ||||             :.:.:|.||:|:.:.........|.:..||  :.|..:..|.    :.
Human   275 AHCL-------------YQAKRFKVRVGDRNTEQEEGGEAVHEVEVV--IKHNRFTKET----YD 320

  Fly   214 NDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQVT-----AAGWGFTAD-GVKSSHLLKVNLQRF 272
            .|||::.|.....|..:||..|||.....:...:|     .:|:|.|.: |.:|:.|..:.:...
Human   321 FDIAVLRLKTPITFRMNVAPACLPERDWAESTLMTQKTGIVSGFGRTHEKGRQSTRLKMLEVPYV 385

  Fly   273 SDEVCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQ 337
            ....|:....|.| |:..||||..:.|.|.|.||||||...:   :.....|.||||:|..|..:
Human   386 DRNSCKLSSSFII-TQNMFCAGYDTKQEDACQGDSGGPHVTR---FKDTYFVTGIVSWGEGCARK 446

  Fly   338 GLPSVYTKVHLYTDWIE 354
            |...:||||..:..||:
Human   447 GKYGIYTKVTAFLKWID 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 77/263 (29%)
Tryp_SPc 102..353 CDD:214473 75/260 (29%)
F10NP_000495.1 GLA 25..85 CDD:214503
EGF_CA 86..122 CDD:238011 8/30 (27%)
FXa_inhibition 129..164 CDD:317114 6/34 (18%)
O-glycosylated at one site 183..203 2/19 (11%)
Tryp_SPc 235..464 CDD:238113 77/263 (29%)
O-glycosylated at one site 476..485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.