DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and F9

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_000124.1 Gene:F9 / 2158 HGNCID:3551 Length:461 Species:Homo sapiens


Alignment Length:384 Identity:96/384 - (25%)
Similarity:154/384 - (40%) Gaps:82/384 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 CDNGTGECKELTPSD---CPVIFYNQHL---IGAEVK--YCDEF------NDIVC---------- 63
            |.|| |.||:...|.   ||..|..::.   :...:|  .|::|      |.:||          
Human   102 CLNG-GSCKDDINSYECWCPFGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAE 165

  Fly    64 ----C----PIPLDHQNLKPAEQTRPFEKQCKQYNEVRSA---------CQSTPF------IVGG 105
                |    |.|....::....:....|......:.|.|.         .|||..      :|||
Human   166 NQKSCEPAVPFPCGRVSVSQTSKLTRAETVFPDVDYVNSTEAETILDNITQSTQSFNDFTRVVGG 230

  Fly   106 TKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPK 170
            ..|...:||:..::        ...::..||||:|:.|:::|||||:||             ..|
Human   231 EDAKPGQFPWQVVL--------NGKVDAFCGGSIVNEKWIVTAAHCVET-------------GVK 274

  Fly   171 FVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVC 235
            ..|..||  :|....:...|...|:..:.|..|:....:  :.:||||:|||.....|.:|..:|
Human   275 ITVVAGE--HNIEETEHTEQKRNVIRIIPHHNYNAAINK--YNHDIALLELDEPLVLNSYVTPIC 335

  Fly   236 LPPDSGNDV----QQVTAAGWGFTADGVKSSHLLK-VNLQRFSDEVCQKRLRFSIDTRTQFCAGS 295
            :......::    .....:|||......:|:.:|: :.:.......|.:..:|:| ....||||.
Human   336 IADKEYTNIFLKFGSGYVSGWGRVFHKGRSALVLQYLRVPLVDRATCLRSTKFTI-YNNMFCAGF 399

  Fly   296 MSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIE 354
            .....|:|.||||||...:   ......:.||:|:|..|..:|...:||||..|.:||:
Human   400 HEGGRDSCQGDSGGPHVTE---VEGTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIK 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 71/258 (28%)
Tryp_SPc 102..353 CDD:214473 69/255 (27%)
F9NP_000124.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011 10/27 (37%)
FXa_inhibition 134..170 CDD:317114 6/35 (17%)
Tryp_SPc 227..457 CDD:238113 71/258 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.