DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and F7

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_011535776.2 Gene:F7 / 2155 HGNCID:3544 Length:495 Species:Homo sapiens


Alignment Length:359 Identity:98/359 - (27%)
Similarity:149/359 - (41%) Gaps:73/359 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CKELTPS----DCPVIFYNQHLIGAEVKYCDEFN----------------DIVCCPIPLDHQNLK 74
            |..|.||    |..:|..|::  |...:||.:..                |.|.|...:::    
Human   164 CSALVPSSPDKDDQLICVNEN--GGCEQYCSDHTGTKRSCRCHEGYSLLADGVSCTPTVEY---- 222

  Fly    75 PAEQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSV 139
            |..:....||        |:|.:....||||......|.|:..|:..:....        |||::
Human   223 PCGKIPILEK--------RNASKPQGRIVGGKVCPKGECPWQVLLLVNGAQL--------CGGTL 271

  Fly   140 VHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYD 204
            ::..:|::||||.  |:.|..|        ..:..|||.|.:....|.  |..||...::...| 
Human   272 INTIWVVSAAHCF--DKIKNWR--------NLIAVLGEHDLSEHDGDE--QSRRVAQVIIPSTY- 323

  Fly   205 TEDEEQGFKN-DIALVELDRKAEFNDHVAAVCLPPDSGND-----VQQVTAAGWGFTAD-GVKSS 262
                ..|..| ||||:.|.:.....|||..:|||..:.::     |:....:|||...| |..:.
Human   324 ----VPGTTNHDIALLRLHQPVVLTDHVVPLCLPERTFSERTLAFVRFSLVSGWGQLLDRGATAL 384

  Fly   263 HLLKVNLQRFSDEVCQKRLRFSID----TRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQ 323
            .|:.:|:.|...:.|.::.|...|    |...||||......|:|.|||||| ...|  |.....
Human   385 ELMVLNVPRLMTQDCLQQSRKVGDSPNITEYMFCAGYSDGSKDSCKGDSGGP-HATH--YRGTWY 446

  Fly   324 VIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIV 357
            :.||||:|..|.:.|...|||:|..|.:|::.::
Human   447 LTGIVSWGQGCATVGHFGVYTRVSQYIEWLQKLM 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 80/264 (30%)
Tryp_SPc 102..353 CDD:214473 79/261 (30%)
F7XP_011535776.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.