DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and F2

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_000497.1 Gene:F2 / 2147 HGNCID:3535 Length:622 Species:Homo sapiens


Alignment Length:411 Identity:103/411 - (25%)
Similarity:157/411 - (38%) Gaps:113/411 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ASVSVVTEYCDNGTGE----------------------CKELT----------PSDCPV------ 40
            ::|.:|..:|.|..|:                      |:|..          .||..:      
Human   253 SAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEETGDGLDEDSDRAIEGRTAT 317

  Fly    41 ----IFYNQHLIGAEVKYCDEFNDIVCCPIPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQS--T 99
                .|:|....|:....|                .|:|.     |||:..:....|...:|  .
Human   318 SEYQTFFNPRTFGSGEADC----------------GLRPL-----FEKKSLEDKTERELLESYID 361

  Fly   100 PFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDP 164
            ..||.|:.|.....|:..::....|.:..      ||.|::..::||||||||     .....|.
Human   362 GRIVEGSDAEIGMSPWQVMLFRKSPQELL------CGASLISDRWVLTAAHCL-----LYPPWDK 415

  Fly   165 NFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYV-VHPGYDTEDEEQGFKNDIALVELDRKAEFN 228
            ||.....:||:|:  ::.|..:..::...::..: :||.|:.   .:....||||::|.:...|:
Human   416 NFTENDLLVRIGK--HSRTRYERNIEKISMLEKIYIHPRYNW---RENLDRDIALMKLKKPVAFS 475

  Fly   229 DHVAAVCLPPDSGNDVQQVTAA------------GWG-----FTADGVKS--SHLLKVNLQRFSD 274
            |::..||||       .:.|||            |||     :||:..|.  |.|..|||.....
Human   476 DYIHPVCLP-------DRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVER 533

  Fly   275 EVCQKRLRFSIDTRTQFCAG---SMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGS 336
            .||:...|..| |...||||   ....:.|.|.||||||..::.|......| :||||:|..|..
Human   534 PVCKDSTRIRI-TDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQ-MGIVSWGEGCDR 596

  Fly   337 QGLPSVYTKVHLYTDWIESIV 357
            .|....||.|.....||:.::
Human   597 DGKYGFYTHVFRLKKWIQKVI 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 83/276 (30%)
Tryp_SPc 102..353 CDD:214473 81/273 (30%)
F2NP_000497.1 GLA 25..88 CDD:214503
KR 105..186 CDD:238056
KR 211..293 CDD:214527 6/39 (15%)
Thrombin_light 317..363 CDD:286482 11/66 (17%)
Tryp_SPc 363..613 CDD:214473 81/274 (30%)
Tryp_SPc 364..616 CDD:238113 83/276 (30%)
High affinity receptor-binding region which is also known as the TP508 peptide 551..573 10/21 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.