DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CELA1

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001962.3 Gene:CELA1 / 1990 HGNCID:3308 Length:258 Species:Homo sapiens


Alignment Length:267 Identity:75/267 - (28%)
Similarity:121/267 - (45%) Gaps:35/267 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNF 166
            :||||:|....:|....: .:|...|:..   .|||:::...:|:|||||::..::         
Human    19 VVGGTEAGRNSWPSQISL-QYRSGGSRYH---TCGGTLIRQNWVMTAAHCVDYQKT--------- 70

  Fly   167 DSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHV 231
                |.|..|  |:|.:.:|...|...|...||||.:::::...|:  ||||:.|.:....|.:|
Human    71 ----FRVVAG--DHNLSQNDGTEQYVSVQKIVVHPYWNSDNVAAGY--DIALLRLAQSVTLNSYV 127

  Fly   232 AAVCLPPD----SGNDVQQVTAAGWGFT-ADGVKSSHLLKVNLQRFSDEVCQKRLRF-SIDTRTQ 290
            ....||.:    :.|....:|  |||.| .:|..:..|.:..|......:|.....: |....|.
Human   128 QLGVLPQEGAILANNSPCYIT--GWGKTKTNGQLAQTLQQAYLPSVDYAICSSSSYWGSTVKNTM 190

  Fly   291 FCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSY--GLVCGSQGLPSVYTKVHLYTDWI 353
            .|||....::. |.||||||:   |.|......|.|:.|:  ...|.....|:|:|:|..|..||
Human   191 VCAGGDGVRSG-CQGDSGGPL---HCLVNGKYSVHGVTSFVSSRGCNVSRKPTVFTQVSAYISWI 251

  Fly   354 ESIVWGN 360
            .:::..|
Human   252 NNVIASN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 74/261 (28%)
Tryp_SPc 102..353 CDD:214473 72/258 (28%)
CELA1NP_001962.3 Tryp_SPc 19..254 CDD:238113 74/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.