DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Tmprss15

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_032967.1 Gene:Tmprss15 / 19146 MGIID:1197523 Length:1069 Species:Mus musculus


Alignment Length:391 Identity:100/391 - (25%)
Similarity:173/391 - (44%) Gaps:89/391 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YCDNGTGE--CKEL---TPSDCPVIFYNQHL---IGAEVKYCDEFNDIVCCPIPLDHQNLK-PAE 77
            :|.:|:.|  |...   |.|:..::.:|.|.   |.....:..:.::.||..:.|...|.. |..
Mouse   712 HCRDGSDEASCVRFLNGTRSNNGLVQFNIHSIWHIACAENWTTQISNEVCHLLGLGSANSSMPIS 776

  Fly    78 QT--RPFEK---------------QCKQYNEVRSAC------------QSTPFIVGGTKASGKEF 113
            .|  .||.:               ||.|.:.:...|            :.:|.||||:.|....:
Mouse   777 STGGGPFVRVNQAPNGSLILTPSLQCSQDSLILLQCNHKSCGEKKVTQKVSPKIVGGSDAQAGAW 841

  Fly   114 PFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGEL 178
            |::..: .||   .:|.....||.|:|...::::||||:         ...|.|..::...||..
Mouse   842 PWVVAL-YHR---DRSTDRLLCGASLVSSDWLVSAAHCV---------YRRNLDPTRWTAVLGLH 893

  Fly   179 DYNSTTDDALVQDFRVVN-YVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGN 242
            ..::.|...:|:  |||: .|::|.||...:    .||||::.|:.|..:.|::..:|||.:  |
Mouse   894 MQSNLTSPQVVR--RVVDQIVINPHYDRRRK----VNDIAMMHLEFKVNYTDYIQPICLPEE--N 950

  Fly   243 DV----QQVTAAGWGF-------TADGVKSSHLLKVNLQRFSDEVCQKRL-RFSIDTRTQFCAGS 295
            .:    :..:.||||:       |.|.:|     :.::...|:|.||::| .::| |.:..|||.
Mouse   951 QIFIPGRTCSIAGWGYDKINAGSTVDVLK-----EADVPLISNEKCQQQLPEYNI-TESMICAGY 1009

  Fly   296 MSSQADTCNGDSGGPIFVQHPLYPCLKQ----VIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESI 356
            .....|:|.||||||:.       |.:.    ::|:.|:|:.|.....|.||.:|..:.:||.|.
Mouse  1010 EEGGIDSCQGDSGGPLM-------CQENNRWFLVGVTSFGVQCALPNHPGVYVRVSQFIEWIHSF 1067

  Fly   357 V 357
            :
Mouse  1068 L 1068

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 77/270 (29%)
Tryp_SPc 102..353 CDD:214473 75/267 (28%)
Tmprss15NP_032967.1 SEA 53..154 CDD:214554
LDLa 228..261 CDD:197566
CUB 270..376 CDD:294042
MAM 392..549 CDD:279023
MAM 392..547 CDD:99706
CUB 569..676 CDD:278839
LDLa 688..722 CDD:238060 3/9 (33%)
SR 723..816 CDD:214555 17/92 (18%)
SRCR 728..819 CDD:278931 17/90 (19%)
Tryp_SPc 829..1064 CDD:214473 75/268 (28%)
Tryp_SPc 830..1066 CDD:238113 77/269 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.