DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Prss12

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_032965.1 Gene:Prss12 / 19142 MGIID:1100881 Length:761 Species:Mus musculus


Alignment Length:266 Identity:79/266 - (29%)
Similarity:125/266 - (46%) Gaps:35/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNF 166
            |:||..:....:|:.|.:   |...:..|....||.:::...:|||||||.       :|...| 
Mouse   517 IIGGNNSLRGAWPWQASL---RLRSAHGDGRLLCGATLLSSCWVLTAAHCF-------KRYGNN- 570

  Fly   167 DSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVEL----DRKAEF 227
             |..:.||:|  ||::...:...|:..|...|:|..|..:..:.    |||||.|    ::.|..
Mouse   571 -SRSYAVRVG--DYHTLVPEEFEQEIGVQQIVIHRNYRPDRSDY----DIALVRLQGPGEQCARL 628

  Fly   228 NDHVAAVCLPPDSGNDVQQVTAA-----GWGFTADGVKSSHLLKVNLQRFSDEVCQKRLRFSIDT 287
            :.||...|||  ...:..|.||:     |||.|.... |..|.:..:.......|::|.: .:.|
Mouse   629 STHVLPACLP--LWRERPQKTASNCHITGWGDTGRAY-SRTLQQAAVPLLPKRFCKERYK-GLFT 689

  Fly   288 RTQFCAGSM--SSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYT 350
            ....|||::  .::.|:|.||||||:..:.|....:  |.|:.|:|..||.:..|.|||:|..:.
Mouse   690 GRMLCAGNLQEDNRVDSCQGDSGGPLMCEKPDESWV--VYGVTSWGYGCGVKDTPGVYTRVPAFV 752

  Fly   351 DWIESI 356
            .||:|:
Mouse   753 PWIKSV 758

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 78/264 (30%)
Tryp_SPc 102..353 CDD:214473 76/261 (29%)
Prss12NP_032965.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 25..87
KR 83..159 CDD:214527
SR 166..265 CDD:214555
SRCR 171..265 CDD:278931
SR 273..372 CDD:214555
SRCR 278..371 CDD:278931
SR 386..485 CDD:214555
SRCR 396..485 CDD:278931
Zymogen activation region 505..516
Tryp_SPc 516..755 CDD:214473 76/261 (29%)
Tryp_SPc 517..758 CDD:238113 78/264 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.