DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Plau

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_032899.1 Gene:Plau / 18792 MGIID:97611 Length:433 Species:Mus musculus


Alignment Length:417 Identity:101/417 - (24%)
Similarity:156/417 - (37%) Gaps:111/417 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 CDNGTGEC------KELTPSDCPVIFYNQHLIGAEVKYCDEFN---------------------- 59
            |.|| |.|      ..:....||..|..:|......|.|...|                      
Mouse    34 CQNG-GVCVSYKYFSRIRRCSCPRKFQGEHCEIDASKTCYHGNGDSYRGKANTDTKGRPCLAWNA 97

  Fly    60 -------------DIVCCPIPLDHQNLKPAEQTRP----------FEKQCKQYN-----EVRSAC 96
                         |.:...:...:....|..|.||          |.::|..::     :..|:.
Mouse    98 PAVLQKPYNAHRPDAISLGLGKHNYCRNPDNQKRPWCYVQIGLRQFVQECMVHDCSLSKKPSSSV 162

  Fly    97 QSTPF------------IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAA 149
            ....|            ||||.....:..|:.|.|  ::.||..|..::.||||::.|.:|.:||
Mouse   163 DQQGFQCGQKALRPRFKIVGGEFTEVENQPWFAAI--YQKNKGGSPPSFKCGGSLISPCWVASAA 225

  Fly   150 HCLETDESKAERLDPNFDSPK---FVVRLG---ELDYNSTTDDALVQDFRVVNYVVHPGYDTEDE 208
            ||.             ...||   :||.||   |..||...     ..|.|...::|..|  .::
Mouse   226 HCF-------------IQLPKKENYVVYLGQSKESSYNPGE-----MKFEVEQLILHEYY--RED 270

  Fly   209 EQGFKNDIALVEL----DRKAEFNDHVAAVCLPP---DS--GNDVQQVTAAGWGFTADGVKSSHL 264
            ...:.|||||:::    .:.|:.:..:..:||||   |:  |:|. ::|..|....:|.:...:|
Mouse   271 SLAYHNDIALLKIRTSTGQCAQPSRSIQTICLPPRFTDAPFGSDC-EITGFGKESESDYLYPKNL 334

  Fly   265 LKVNLQRFSDEVCQKRLRFSIDTR-TQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIV 328
            ....::..|.|.|.:...:..:.. ...||.....:.|:|.||||||:.......|.|.   |||
Mouse   335 KMSVVKLVSHEQCMQPHYYGSEINYKMLCAADPEWKTDSCKGDSGGPLICNIEGRPTLS---GIV 396

  Fly   329 SYGLVCGSQGLPSVYTKVHLYTDWIES 355
            |:|..|..:..|.|||:|..:.|||:|
Mouse   397 SWGRGCAEKNKPGVYTRVSHFLDWIQS 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 80/270 (30%)
Tryp_SPc 102..353 CDD:214473 77/266 (29%)
PlauNP_032899.1 Binds urokinase plasminogen activator surface receptor. /evidence=ECO:0000250 35..58 6/23 (26%)
Kringle 71..152 CDD:333799 9/80 (11%)
Connecting peptide 153..179 2/25 (8%)
Tryp_SPc 180..424 CDD:238113 80/270 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.