DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and try-6

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001361988.1 Gene:try-6 / 185959 WormBaseID:WBGene00006624 Length:343 Species:Caenorhabditis elegans


Alignment Length:284 Identity:68/284 - (23%)
Similarity:112/284 - (39%) Gaps:62/284 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 VCCPIPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNK 126
            :|..:.:|.:.|...|..:..| .|.:  .|:|.      |..|.||...|.|:...|.|: .|.
 Worm    10 ICLIVFVDSRKLTAEENEKRLE-DCGK--NVKSK------IFNGRKAEIDEAPWAVRINTY-TNV 64

  Fly   127 SKSDINWD--CGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSP-------------------- 169
            ...|..|.  |.|::..|:.:|||.||..| .::.|......|:|                    
 Worm    65 KNIDETWSKHCSGTLTSPRHILTATHCAAT-YTETEWNGTVIDAPIYRKYCEEQSTLIVREVAAS 128

  Fly   170 KFVVRLGELDYNSTTDDALVQDFRVVNY---VVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHV 231
            :.||||     .:.|:....:...:.||   :|    |....|..:.:||.::||....|::..:
 Worm   129 RIVVRL-----RNRTEIGRAKYLFMFNYCRKIV----DKNAYEIQYPDDIMIIELSEDVEYSSEL 184

  Fly   232 AAVCLPPDSGNDVQQVTAAGWGFTAD-------GVKSSHLL-----KVNLQRFSDEVCQKRLRFS 284
            ..||:..::.::........:||..|       .:|:.|.:     ||.:...:.|...||:   
 Worm   185 KPVCVAGNTDDNAPNSHLDLFGFGDDPPRDKPSSLKNLHDIPLKHHKVEIMDMNKEGTSKRM--- 246

  Fly   285 IDTRTQFCAGSMSSQADTCNGDSG 308
             |.|. |.|.|::..:..|.||||
 Worm   247 -DPRL-FIAKSVTRTSVACPGDSG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 60/244 (25%)
Tryp_SPc 102..353 CDD:214473 60/244 (25%)
try-6NP_001361988.1 DUF316 7..320 CDD:367641 68/284 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.