DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and svh-1

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_501379.2 Gene:svh-1 / 182375 WormBaseID:WBGene00006620 Length:951 Species:Caenorhabditis elegans


Alignment Length:293 Identity:88/293 - (30%)
Similarity:141/293 - (48%) Gaps:54/293 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 QC-KQYNEV--RSACQS-TPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFV 145
            || .:|.||  |.|.:| ...:|||.:.....||:.|.:      ::|:.....||.|::....:
 Worm   692 QCGLRYVEVNARDAAKSRIARVVGGFETVPGAFPWTAAL------RNKATKAHHCGASILDKTHL 750

  Fly   146 LTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQ 210
            :|||||.|.||..:          .:.|.:|:.|.|.|  |...|.|.:.....:|.|     :.
 Worm   751 ITAAHCFEEDERVS----------SYEVVVGDWDNNQT--DGNEQIFYLQRIHFYPLY-----KD 798

  Fly   211 GFKNDIALVELDRKA-EFNDHVAAVCLPPDSGNDV----QQVTAAGWGFTADGVKSSHLLKVNL- 269
            .|.:|||::|:.... |||::...:|||  |.:.|    :|...:|||  :.|::.:..|:..| 
 Worm   799 IFSHDIAILEIPYPGIEFNEYAQPICLP--SKDFVYTPGRQCVVSGWG--SMGLRYAERLQAALI 859

  Fly   270 ---QRFSDEVCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQ-----VIG 326
               .|| |.|...:: :|..:|:.||||.:....|:|.||||||       :.|.::     :.|
 Worm   860 PIINRF-DCVNSSQI-YSSMSRSAFCAGYLEGGIDSCQGDSGGP-------FACRREDGAFVLAG 915

  Fly   327 IVSYGLVCGSQGLPSVYTKVHLYTDWIESIVWG 359
            ::|:|..|..:..|.:||.|..|..||.:|:.|
 Worm   916 VISWGDGCAQKKQPGIYTMVAPYLSWISAIING 948

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 78/267 (29%)
Tryp_SPc 102..353 CDD:214473 76/264 (29%)
svh-1NP_501379.2 KR 227..306 CDD:214527
LDLa 320..355 CDD:238060
PAN_AP_HGF 373..434 CDD:238532
LDLa 558..590 CDD:197566
SRCR_2 599..681 CDD:382996
Tryp_SPc 713..945 CDD:238113 78/267 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.