DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and try-1

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:285 Identity:78/285 - (27%)
Similarity:125/285 - (43%) Gaps:63/285 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 EVRSACQSTPFI------VGGTKASGKEFPF----MALIGTHRPNKSKSDINWDCGGSVVHPKFV 145
            :.|||.:...::      :||:::|...:|:    ::.:|.||           ||||::.|.||
 Worm    41 QTRSAQEPADYVTLDHRLIGGSESSPHSWPWTVQLLSRLGHHR-----------CGGSLIDPNFV 94

  Fly   146 LTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQ 210
            ||||||...|....          .:.||:|.....|.:      ..||....:||.|:.     
 Worm    95 LTAAHCFAKDRRPT----------SYSVRVGGHRSGSGS------PHRVTAVSIHPWYNI----- 138

  Fly   211 GFKN--DIALVELDRKAEFNDHVAAVCLP--PDSGNDVQQVTAAGWGFTADG--VKSSHLLKVNL 269
            ||.:  |.|::.:......:.....:|||  |...|.:..||  |||.|.:|  :.:..|.::::
 Worm   139 GFPSSYDFAIMRIHPPVNTSTTARPICLPSLPAVENRLCVVT--GWGSTIEGSSLSAPTLREIHV 201

  Fly   270 QRFSDEVCQKRLRF--SIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLK----QVIGIV 328
            ...|...|.....:  .|...:..|||....:.|:|.||||||:.       |.:    ::.|:|
 Worm   202 PLLSTLFCSSLPNYIGRIHLPSMLCAGYSYGKIDSCQGDSGGPLM-------CARDGHWELTGVV 259

  Fly   329 SYGLVCGSQGLPSVYTKVHLYTDWI 353
            |:|:.|...|:|.||..||..:.||
 Worm   260 SWGIGCARPGMPGVYGNVHSASTWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 75/274 (27%)
Tryp_SPc 102..353 CDD:214473 73/272 (27%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 75/267 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.