DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Mcpt2

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_032597.1 Gene:Mcpt2 / 17225 MGIID:96938 Length:244 Species:Mus musculus


Alignment Length:262 Identity:76/262 - (29%)
Similarity:116/262 - (44%) Gaps:47/262 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNF 166
            |:||.:|.....|:||.:.....|.||.    .|||.::.|:||:|||||               
Mouse    21 IIGGVEAKPHSRPYMAYLKFTTKNGSKE----RCGGFLIAPQFVMTAAHC--------------- 66

  Fly   167 DSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHV 231
            :..:..|.||.  :|...::...|..:.....|||.:   ....|| .||.|::|.:|||.|..|
Mouse    67 NGSEISVILGA--HNINKNEPTQQIIKTEKTFVHPKF---QYLSGF-YDIMLLKLQKKAELNSDV 125

  Fly   232 AAVCLPPDSGNDV----QQVTAAGWGFTA-DGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQF 291
            ..:.||  |.:|.    :....||||.|. :...|..|.:|.|:....|.|:....:  |.:.|.
Mouse   126 DVISLP--SSSDFIKPGKMCWTAGWGKTGKNNPLSVTLREVELRIMDQEACKDHSDY--DYQLQV 186

  Fly   292 CAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQG-LPSVYTKVHLYTDWIES 355
            ||||.::......||||||:            |...|::|:....:. .|:|:|::..|..||..
Mouse   187 CAGSPTTSKSIGQGDSGGPL------------VCDSVAHGIASSYEAKAPAVFTRISYYLPWIYK 239

  Fly   356 IV 357
            ::
Mouse   240 VL 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 76/259 (29%)
Tryp_SPc 102..353 CDD:214473 74/256 (29%)
Mcpt2NP_032597.1 Tryp_SPc 20..237 CDD:214473 74/256 (29%)
Tryp_SPc 21..240 CDD:238113 76/259 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.