DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Masp1

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_036015702.1 Gene:Masp1 / 17174 MGIID:88492 Length:746 Species:Mus musculus


Alignment Length:418 Identity:109/418 - (26%)
Similarity:159/418 - (38%) Gaps:113/418 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ECKEL--------TPSDCPVIFYNQHLIGAEVKY--------CDEF-----------NDIVCC-- 64
            ||.:|        .||.....|.:|.|:..:..|        .|.|           |.|..|  
Mouse   305 ECPKLQPPVYGKIEPSQAVYSFKDQVLVSCDTGYKVLKDNEVMDTFQIECLKDGAWSNKIPTCKI 369

  Fly    65 -----PIPLDH--------QNLKPAEQ------TRPFEKQ---------CKQY----NEV--RSA 95
                 |..|.|        .||...:.      .:|:.|.         |..:    |||  ||.
Mouse   370 VDCGAPAGLKHGLVTFSTRNNLTTYKSEIRYSCQQPYYKMLHNTTGVYTCSAHGTWTNEVLKRSL 434

  Fly    96 CQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINW-----------DCGGSVVHPKFVLTAA 149
            ....| :.|..|.|.|:   ::.|...|| ..|..:.|           .||||::...:|||||
Mouse   435 PTCLP-VCGVPKFSRKQ---ISRIFNGRP-AQKGTMPWIAMLSHLNGQPFCGGSLLGSNWVLTAA 494

  Fly   150 HCLETDESKAERLDPN--------FDSPK-FVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDT 205
            |||.      :.|||.        ..||. |.:.:|:.....:.:|.  |...|....:||.|:.
Mouse   495 HCLH------QSLDPEEPTLHSSYLLSPSDFKIIMGKHWRRRSDEDE--QHLHVKRTTLHPLYNP 551

  Fly   206 EDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQVTAAGWGFTADGVKSSHLLKVNLQ 270
            ..    |:||:.||||......||.|..||||.....:...|..:|||.........:|:::.:.
Mouse   552 ST----FENDLGLVELSESPRLNDFVMPVCLPEQPSTEGTMVIVSGWGKQFLQRFPENLMEIEIP 612

  Fly   271 RFSDEVCQKR---LRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFV----QHPLYPCLKQVIGIV 328
            ..:.:.||:.   |:..: |:...|||......|.|.||||||:..    :...|     ::|:|
Mouse   613 IVNSDTCQEAYTPLKKKV-TKDMICAGEKEGGKDACAGDSGGPMVTKDAERDQWY-----LVGVV 671

  Fly   329 SYGLVCGSQGLPSVYTKVHLYTDWIESI 356
            |:|..||.:....||:.::...|||:.|
Mouse   672 SWGEDCGKKDRYGVYSYIYPNKDWIQRI 699

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 80/280 (29%)
Tryp_SPc 102..353 CDD:214473 78/277 (28%)
Masp1XP_036015702.1 CUB 33..142 CDD:238001
FXa_inhibition 158..186 CDD:405372
CUB 190..299 CDD:395345
PHA02639 <305..>438 CDD:165022 27/132 (20%)
CCP 306..368 CDD:153056 12/61 (20%)
Tryp_SPc 454..699 CDD:238113 76/263 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.