DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Gzmb

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_612526.2 Gene:Gzmb / 171528 RGDID:620018 Length:248 Species:Rattus norvegicus


Alignment Length:261 Identity:81/261 - (31%)
Similarity:114/261 - (43%) Gaps:47/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMA---LIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLD 163
            |:||.:|.....|:||   ::..:..:|.       |||.::...||||||||            
  Rat    21 IIGGHEAKPHSRPYMAYLQIMDEYSGSKK-------CGGFLIREDFVLTAAHC------------ 66

  Fly   164 PNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFN 228
               ...|..|.||.  :|....:.:.|...||..:.||.|:::.    ..|||.|::|..||:.:
  Rat    67 ---SGSKINVTLGA--HNIKEQEKMQQIIPVVKIIPHPAYNSKT----ISNDIMLLKLKSKAKRS 122

  Fly   229 DHVAAVCLPPDS----GNDVQQVTAAGWGFTAD-GVKSSHLLKVNLQRFSDEVCQKRLRFSIDTR 288
            ..|..:.||..:    ..||..|  ||||.... |..|..|.:|.|....|:.|:..|:...|..
  Rat   123 SAVKPLNLPRRNVKVKPGDVCYV--AGWGKLGPMGKYSDTLQEVELTVQEDQKCESYLKNYFDKA 185

  Fly   289 TQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
            .:.|||....:..:..||||||:.       |.|...||||||...||  .|..:|||..:..||
  Rat   186 NEICAGDPKIKRASFRGDSGGPLV-------CKKVAAGIVSYGQNDGS--TPRAFTKVSTFLSWI 241

  Fly   354 E 354
            :
  Rat   242 K 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 81/261 (31%)
Tryp_SPc 102..353 CDD:214473 79/258 (31%)
GzmbNP_612526.2 Tryp_SPc 20..241 CDD:214473 79/258 (31%)
Tryp_SPc 21..244 CDD:238113 81/261 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.