DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and TMPRSS6

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001275929.1 Gene:TMPRSS6 / 164656 HGNCID:16517 Length:824 Species:Homo sapiens


Alignment Length:391 Identity:102/391 - (26%)
Similarity:156/391 - (39%) Gaps:94/391 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 CDNG----------TGECKELTPSDC---PVIFYNQH--LIGAEVKYCDEFNDIVCCPIPLDHQN 72
            |.||          |.:|||  .|.|   |.:...|.  |.|::.:.|.|  .:.|.......::
Human   471 CPNGLDERNCVCRATFQCKE--DSTCISLPKVCDGQPDCLNGSDEEQCQE--GVPCGTFTFQCED 531

  Fly    73 LKPAEQTRPFEKQCKQYNEVRSACQS----------TPFIVGGTKASGKEFPFMALI---GTHRP 124
            ....::..|   ||....:.|.....          :..||||..:|..|:|:.|.:   |.|  
Human   532 RSCVKKPNP---QCDGRPDCRDGSDEEHCDCGLQGPSSRIVGGAVSSEGEWPWQASLQVRGRH-- 591

  Fly   125 NKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALV 189
                     .|||:::..::|:|||||.:.|...:..|        :.|.||::..||.....: 
Human   592 ---------ICGGALIADRWVITAAHCFQEDSMASTVL--------WTVFLGKVWQNSRWPGEV- 638

  Fly   190 QDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSG--NDVQQVTAAGW 252
             .|:|...::||.:    ||.....|:||::||.....:..|..||||..|.  .........||
Human   639 -SFKVSRLLLHPYH----EEDSHDYDVALLQLDHPVVRSAAVRPVCLPARSHFFEPGLHCWITGW 698

  Fly   253 G------FTADGVK-----------------SSHLLKVNLQRFSDEVCQKRLRFSIDTRTQFCAG 294
            |      ..||.|.                 |:.|.||::|....::|.:..|:.:..| ..|||
Human   699 GALREGALRADAVALFYGWRNQGSETCCCPISNALQKVDVQLIPQDLCSEVYRYQVTPR-MLCAG 762

  Fly   295 SMSSQADTCNGDSGGPIFVQHPLYPCLKQ---VIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESI 356
            ....:.|.|.||||||:..:     .|..   :.|:||:||.||......|||::.....||:.:
Human   763 YRKGKKDACQGDSGGPLVCK-----ALSGRWFLAGLVSWGLGCGRPNYFGVYTRITGVISWIQQV 822

  Fly   357 V 357
            |
Human   823 V 823

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 81/284 (29%)
Tryp_SPc 102..353 CDD:214473 79/281 (28%)
TMPRSS6NP_001275929.1 SEA 77..177 CDD:307516
CUB 326..440 CDD:238001
LDLa 450..480 CDD:238060 3/8 (38%)
LDLa 486..516 CDD:238060 9/31 (29%)
Ldl_recept_a 520..557 CDD:278486 5/39 (13%)
Tryp_SPc 568..822 CDD:238113 81/284 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.