DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CTSG

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_011534801.1 Gene:CTSG / 1511 HGNCID:2532 Length:269 Species:Homo sapiens


Alignment Length:285 Identity:79/285 - (27%)
Similarity:119/285 - (41%) Gaps:74/285 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 EVRSACQSTPFIVGGTKASGKEFPFMALIGTHRP-NKSKSDINWDCGGSVVHPKFVLTAAHCLET 154
            |:.:.|.....|:||.::.....|:||.:....| .:|:      |||.:|...||||||||..:
Human    24 ELSAKCFLPGEIIGGRESRPHSRPYMAYLQIQSPAGQSR------CGGFLVREDFVLTAAHCWGS 82

  Fly   155 DESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALV 219
            :.:               |.||.  :|....:...|.......:.||.|:    ::..:|||.|:
Human    83 NIN---------------VTLGA--HNIQRRENTQQHITARRAIRHPQYN----QRTIQNDIMLL 126

  Fly   220 ELDRKAEFNDHVAAVCLP-------PDSGNDVQQVTAAGWGFTADGVKSSHLLKVNLQRFSDEVC 277
            :|.|:...|.:|..|.||       |.:     ..|.||||            :|:::|.:|.:.
Human   127 QLSRRVRRNRNVNPVALPRAQEGLRPGT-----LCTVAGWG------------RVSMRRGTDTLR 174

  Fly   278 QKRLRF-----------SIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYG 331
            :.:||.           |.|.|.|.|.|....:.....||||||:.       |.....||||||
Human   175 EVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLL-------CNNVAHGIVSYG 232

  Fly   332 LVCGSQGL-PSVYTKVHLYTDWIES 355
               .|.|: |.|:|:|..:..||.:
Human   233 ---KSSGVPPEVFTRVSSFLPWIRT 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 77/274 (28%)
Tryp_SPc 102..353 CDD:214473 75/270 (28%)
CTSGXP_011534801.1 Tryp_SPc 34..252 CDD:214473 75/271 (28%)
Tryp_SPc 35..255 CDD:238113 77/274 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.