DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CTRL

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001898.1 Gene:CTRL / 1506 HGNCID:2524 Length:264 Species:Homo sapiens


Alignment Length:302 Identity:82/302 - (27%)
Similarity:129/302 - (42%) Gaps:67/302 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 CPIPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSK 128
            |.||.    :|||   ..|.::.  .|...:...|.|:.|....:||..|               
Human    19 CGIPA----IKPA---LSFSQRI--VNGENAVLGSWPWQVSLQDSSGFHF--------------- 59

  Fly   129 SDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFR 193
                  ||||::...:|:|||||             |....:..|.|||.|.:|..:.  :|...
Human    60 ------CGGSLISQSWVVTAAHC-------------NVSPGRHFVVLGEYDRSSNAEP--LQVLS 103

  Fly   194 VVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQVT--AAGWGFTA 256
            |...:.||.:::..    ..||:.|::|...|::...::.|||...:....:.:|  ..|||..:
Human   104 VSRAITHPSWNSTT----MNNDVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLS 164

  Fly   257 --DGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYP 319
              ..|..:||.:|.|...:...|::....|| |.:..|||  .:.|.:|.||||||:.       
Human   165 GVGNVTPAHLQQVALPLVTVNQCRQYWGSSI-TDSMICAG--GAGASSCQGDSGGPLV------- 219

  Fly   320 CLK----QVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIV 357
            |.|    .:|||||:|....:...|:|||:|..::.||..::
Human   220 CQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 72/261 (28%)
Tryp_SPc 102..353 CDD:214473 70/258 (27%)
CTRLNP_001898.1 Tryp_SPc 34..260 CDD:238113 75/277 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.