DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Gzmk

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_032222.1 Gene:Gzmk / 14945 MGIID:1298232 Length:263 Species:Mus musculus


Alignment Length:273 Identity:82/273 - (30%)
Similarity:119/273 - (43%) Gaps:47/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 SACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESK 158
            |.|..|. |:||.:......||||.|    ..:||.    .|||.::||::|||||||..     
Mouse    19 SECFHTE-IIGGREVQPHSRPFMASI----QYRSKH----ICGGVLIHPQWVLTAAHCYS----- 69

  Fly   159 AERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDR 223
               ..|...||..|:....|..|    :.:.|.|.:..::..    :..:.....:||.|::|..
Mouse    70 ---WFPRGHSPTVVLGAHSLSKN----EPMKQTFEIKKFIPF----SRLQSGSASHDIMLIKLRT 123

  Fly   224 KAEFNDHVAAVCLPPDSGNDVQ-----QVTAAGWGFTADGV--KSSHLLKVNLQRFSDEVCQKRL 281
            .||.|.:|..:.|  .|.|.::     |||  |||.|...:  .|..|.:|.:...|.:.|..:.
Mouse   124 AAELNKNVQLLHL--GSKNYLRDGTKCQVT--GWGTTKPDLLTASDTLREVTVTIISRKRCNSQS 184

  Fly   282 RFS---IDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVY 343
            .::   :.|:...|||....|.|:|.||||||:.       |......:||.|..||....|.:|
Mouse   185 YYNHKPVITKDMICAGDARGQKDSCKGDSGGPLI-------CKGIFHALVSQGYKCGIAKKPGIY 242

  Fly   344 TKV-HLYTDWIES 355
            |.: ..|..||:|
Mouse   243 TLLTKKYQTWIKS 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 79/265 (30%)
Tryp_SPc 102..353 CDD:214473 76/261 (29%)
GzmkNP_032222.1 Tryp_SPc 25..253 CDD:214473 76/263 (29%)
Tryp_SPc 26..256 CDD:238113 79/265 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.