DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Tmprss3

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001157248.1 Gene:Tmprss3 / 140765 MGIID:2155445 Length:475 Species:Mus musculus


Alignment Length:274 Identity:80/274 - (29%)
Similarity:131/274 - (47%) Gaps:49/274 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 SACQS----TPFIVGGTKASGKEFPFMALI---GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHC 151
            |||.:    :|.||||..:|..::|:...:   |.|.           ||||::.|.:::|||||
Mouse   227 SACGTRTGYSPRIVGGNMSSLTQWPWQVSLQFQGYHL-----------CGGSIITPLWIVTAAHC 280

  Fly   152 LETDESKAERLDPNFD--SPK-FVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFK 213
            :             :|  .|| :.|::|.:    :..|:.|....|...:.|..|    :.:...
Mouse   281 V-------------YDLYHPKSWTVQVGLV----SLMDSPVPSHLVEKIIYHSKY----KPKRLG 324

  Fly   214 NDIALVELDRKAEFNDHVAAVCLPPDSGN--DVQQVTAAGWGFTADGVKSSHLLK-VNLQRFSDE 275
            |||||::|.....|::.:..:|||....|  |.:....:|||.|.||..:|.:|. ..:...|::
Mouse   325 NDIALMKLSEPLTFDETIQPICLPNSEENFPDGKLCWTSGWGATEDGGDASPVLNHAAVPLISNK 389

  Fly   276 VCQKR-LRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGL 339
            :|..| :...|.:.:..|||.:....|:|.||||||:..|...   |.:::|..|:|:.|.....
Mouse   390 ICNHRDVYGGIISPSMLCAGYLKGGVDSCQGDSGGPLVCQERR---LWKLVGATSFGIGCAEVNK 451

  Fly   340 PSVYTKVHLYTDWI 353
            |.|||::..:.|||
Mouse   452 PGVYTRITSFLDWI 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 76/262 (29%)
Tryp_SPc 102..353 CDD:214473 74/260 (28%)
Tmprss3NP_001157248.1 LDLa 96..129 CDD:238060
SRCR_2 134..233 CDD:292133 3/5 (60%)
Tryp_SPc 238..465 CDD:214473 74/261 (28%)
Tryp_SPc 239..468 CDD:238113 76/262 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.