DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP001244

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_321898.3 Gene:AgaP_AGAP001244 / 1281920 VectorBaseID:AGAP001244 Length:279 Species:Anopheles gambiae


Alignment Length:261 Identity:70/261 - (26%)
Similarity:103/261 - (39%) Gaps:66/261 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWD-CGGSVVHPKFVLTAAHCLETDESKAERLDPN 165
            ||||...|         |.||....|....::. ||.|::...:.|||||||..|          
Mosquito    54 IVGGEPVS---------IETHVYQLSLRSYDYHICGASIISSVWALTAAHCLFPD---------- 99

  Fly   166 FDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGY--DTEDEEQGFKNDIALVELDRKAEFN 228
             ..|:.:..|......||..    :.:.....::||.|  .|.|      ||:|::.:      |
Mosquito   100 -PDPRTISLLAGTGSQSTGG----RIYNATRIIIHPMYAPSTMD------NDVAVIRV------N 147

  Fly   229 DHVAAVCLPPDSG---------NDVQQVTA--AGWGFTADGVKSSHLLK-VNLQRFSDEVCQKRL 281
            .|.:.    |::|         ..:..|.|  .|||..::|.|.|..|. |.:.......|..:.
Mosquito   148 THFSG----PNTGYIGVVPLGYEPMAGVRAIVTGWGRQSEGAKQSMTLAGVEIPIVDKAECMDQW 208

  Fly   282 RFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLV-CGSQGLPSVYTK 345
            ...:.:....|||.:..  |:||||||||:...       .:.|||||:|.. ||.. |.::||.
Mosquito   209 SGVLVSPQMICAGELGK--DSCNGDSGGPLVSG-------GRQIGIVSWGSTKCGGP-LAAIYTN 263

  Fly   346 V 346
            :
Mosquito   264 L 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 70/261 (27%)
Tryp_SPc 102..353 CDD:214473 70/261 (27%)
AgaP_AGAP001244XP_321898.3 Tryp_SPc 53..266 CDD:214473 70/261 (27%)
Tryp_SPc 54..276 CDD:238113 70/261 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.