DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP001366

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_321777.4 Gene:AgaP_AGAP001366 / 1281814 VectorBaseID:AGAP001366 Length:563 Species:Anopheles gambiae


Alignment Length:311 Identity:76/311 - (24%)
Similarity:137/311 - (44%) Gaps:50/311 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LDHQNLKPAEQTRPFEKQCKQYNEVRSAC-----QSTPFIVGGTKASGKEFPFMALIGTHRPNKS 127
            |.|::...|.||....|    |.  ...|     ::.|.:..||.:...:||:...:  :|  .:
Mosquito   282 LQHESTPKAGQTHYINK----YE--GDICGTVVPKANPLVTHGTVSERGQFPWHGAL--YR--ST 336

  Fly   128 KSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELD---YNSTTDDALV 189
            .:::.:.||.:::..:..:|||||:..::|...     .|:...::..|::|   :|...:||.:
Mosquito   337 VTELKYLCGATLISRRASITAAHCVTLEKSSKP-----VDAGSLLLYFGKIDLSKWNGPEEDAQI 396

  Fly   190 QDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCL---PPDSGNDVQQV-TAA 250
            :...:         ..:.:.:.|.||||::.|....::::.|..|||   ..|....:.:: ...
Mosquito   397 RSIHI---------PAQYQHERFFNDIAVLVLKEDIKYSNFVRPVCLWNFDDDYKTLINKIGFVP 452

  Fly   251 GWGFTADGVKSSHLLKVNLQRFSDEVC--QKRLRFS-IDTRTQFCAGSMSSQADTCNGDSGGPIF 312
            |||:...|:.||.|....:...:.|.|  ..|..|| :.:.|.|||| ..:....|||||||.:.
Mosquito   453 GWGYNEHGLVSSRLSFAQMPVVAHETCIWSNRDFFSKVTSDTSFCAG-FKNGTSVCNGDSGGGMV 516

  Fly   313 VQHPLYPCLKQVIGIVSYGLV------CGSQGLPSVYTKVHLYTDWIESIV 357
            .:|.....|:   ||||....      |.|:.. .|:|....:|.||:.::
Mosquito   517 FKHNNLWYLR---GIVSVSAALQDRFHCDSKHY-VVFTDAAKFTSWIKGLM 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 67/269 (25%)
Tryp_SPc 102..353 CDD:214473 65/266 (24%)
AgaP_AGAP001366XP_321777.4 GD_N 15..124 CDD:292649
Tryp_SPc 315..560 CDD:238113 66/267 (25%)
Tryp_SPc 315..559 CDD:214473 65/266 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.