DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP001395

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_321740.5 Gene:AgaP_AGAP001395 / 1281782 VectorBaseID:AGAP001395 Length:268 Species:Anopheles gambiae


Alignment Length:283 Identity:86/283 - (30%)
Similarity:130/283 - (45%) Gaps:58/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALI---GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLD 163
            ||||..::..:..::|.:   |.|           .||.|:|:.:::|||.||:.:..:|..|.:
Mosquito    12 IVGGVNSNRGQITYIASLTKRGGH-----------FCGASIVNDRWLLTAGHCVCSGVNKILRAN 65

  Fly   164 PNFDSPKFVVRLG----------ELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIAL 218
                  :....||          ::|.:..:|.|.....|.:  |.||||.....    .|||||
Mosquito    66 ------QIQAVLGLYRRSEFGGNQIDSDPFSDRAYEVGIRTI--VPHPGYVCNKP----SNDIAL 118

  Fly   219 VELDRKAEFNDHVAAVCLPPDSGND----VQQVTA--AGWGFTAD----GVKSSHLLKVNLQRFS 273
            :||.|:.:|:..|..:||  .||.|    |:..||  ||||:..:    |.|:..|.:..:..|.
Mosquito   119 LELARRIDFSASVRPICL--SSGADGSARVEGQTAVVAGWGWQQENRNLGDKADTLQRAVVDVFR 181

  Fly   274 DEVCQKRL----RFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVC 334
            :|.|:...    |.....|||.|||..:...|.|..|||||:.....:      :|||||.|:.|
Mosquito   182 NEECESMYRRGNRSRTIARTQLCAGKGTGGVDACWADSGGPLVTSDNV------LIGIVSTGIGC 240

  Fly   335 GSQGLPSVYTKVHLYTDWIESIV 357
            ...|.|.:||:|..|..||.:::
Mosquito   241 ARPGFPGIYTRVSEYASWIVTVI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 86/280 (31%)
Tryp_SPc 102..353 CDD:214473 84/277 (30%)
AgaP_AGAP001395XP_321740.5 Tryp_SPc 11..259 CDD:214473 84/277 (30%)
Tryp_SPc 12..259 CDD:238113 84/277 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.