DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP011669

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_320844.4 Gene:AgaP_AGAP011669 / 1280970 VectorBaseID:AGAP011669 Length:576 Species:Anopheles gambiae


Alignment Length:296 Identity:80/296 - (27%)
Similarity:121/296 - (40%) Gaps:46/296 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 QTRPFEKQ--CKQYNEVRSACQSTPFIVGGTKASGKEFPF-MALIGTHRPNKSKSDINWDCGGSV 139
            |||..|..  |.:...|     |...|..|..|....:|: :||.  ||.:   :...:.||||:
Mosquito    20 QTRGQENHLTCGKRKVV-----SQYLIHNGIDAKAGHWPWHVALF--HRKD---AQYEYACGGSI 74

  Fly   140 VHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYD 204
            :....:|||:||:.|....       ....:..|.:|.:..|.:::  ..|...|...:||||: 
Mosquito    75 LDENTILTASHCVYTQSGV-------ISISRVSVDVGRIHLNESSE--YTQTHLVREIIVHPGF- 129

  Fly   205 TEDEEQGFKNDIALVELDRKAEFNDHVAAVCL-PPDSGNDV---QQVTAAGWGFTADGVKSSHLL 265
               .:....|||||::|......|.:|..||| ..||..::   :..|..|:|.....|.|..|.
Mosquito   130 ---SKNSIVNDIALIKLSSNITMNKYVQPVCLWTMDSNQELIVGRNGTIVGFGVNEQDVVSEQLK 191

  Fly   266 KVNLQRFSDEVC--QKRLRFSID-TRTQFCAGSMSSQADTCNGDSGGPIF--VQHPLYPCLKQVI 325
            :..:.......|  ..|..|... |...|| |........|||||||.:|  :....:     |.
Mosquito   192 QALIGVVDPLSCIADDRGVFGTHLTSDMFC-GKGQKGVSACNGDSGGGMFFEIGGKWF-----VR 250

  Fly   326 GIVSYGLVCGSQGLPSV----YTKVHLYTDWIESIV 357
            |:||: ...|::...|:    ||.|..|.:||:..:
Mosquito   251 GLVSF-TPLGTEQCDSLKNTAYTDVAKYLEWIKPYI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 73/267 (27%)
Tryp_SPc 102..353 CDD:214473 71/264 (27%)
AgaP_AGAP011669XP_320844.4 Tryp_SPc 41..282 CDD:238113 72/265 (27%)
Tryp_SPc 43..281 CDD:214473 70/262 (27%)
Tryp_SPc 330..568 CDD:214473
Tryp_SPc 330..568 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.