DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP011719

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_320793.4 Gene:AgaP_AGAP011719 / 1280920 VectorBaseID:AGAP011719 Length:762 Species:Anopheles gambiae


Alignment Length:267 Identity:88/267 - (32%)
Similarity:128/267 - (47%) Gaps:38/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 FIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPN 165
            ||..|:.|...||..:|.||..:|:   ..:.|.||||::...::||||||.         .||:
Mosquito    18 FISSGSPAFPGEFAHIAAIGWTQPD---GTVQWKCGGSLIWENYILTAAHCY---------ADPD 70

  Fly   166 FDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDH 230
            ......|:|:|:|:.....||..||:.::|..:.||.::...    ...|:||::||:|...::.
Mosquito    71 TILSPDVIRIGDLNLFDADDDEFVQERKIVQIIRHPLHNAST----VYYDLALLKLDKKVIQSEG 131

  Fly   231 VAAVCLPPDSGNDVQQVTAAGWGFTADG-VKSSHLLKVNLQRFSDEVC--------QKRLRFSID 286
            |...||..|.......:..||||.|..| .||:.|||..|:..::..|        |:||...:.
Mosquito   132 VIPTCLWLDDSIPFSTLEVAGWGQTGFGKEKSNMLLKAELKLMTNTECAKYNNKRTQRRLGNDLA 196

  Fly   287 TRTQFCAGSMSSQADTCNGDSGGP----IFVQHPLYPCLKQVIGIVSYGLVCG-SQGLPSVYTKV 346
            .. |.||  .....|||.||||||    ::.:|...|.|   :|:.|:|..|. ||  |.||.||
Mosquito   197 DH-QLCA--WDEVMDTCPGDSGGPLHYNLYYKHTKIPFL---VGVTSFGKACAVSQ--PGVYVKV 253

  Fly   347 HLYTDWI 353
            ..:..||
Mosquito   254 AKFKQWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 87/266 (33%)
Tryp_SPc 102..353 CDD:214473 85/264 (32%)
AgaP_AGAP011719XP_320793.4 Tryp_SPc 19..263 CDD:238113 87/266 (33%)
Tryp_SPc 19..260 CDD:214473 85/264 (32%)
Tryp_SPc 318..537 CDD:304450
Tryp_SPc 653..>762 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.