DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CLIPA2

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_320727.4 Gene:CLIPA2 / 1280859 VectorBaseID:AGAP011790 Length:503 Species:Anopheles gambiae


Alignment Length:352 Identity:93/352 - (26%)
Similarity:152/352 - (43%) Gaps:67/352 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 EVKYCDEFNDIVCCPIP---LDHQNLKPAEQT------------------------RPFEKQ-CK 87
            |:....|.||:|...|.   :|..:|:..:.|                        ..|..| |.
Mosquito   162 ELTSSSESNDLVTSIIDTALVDDNSLQETDTTTIPVIPPNAADPPPTPALTAQFTPESFSYQDCG 226

  Fly    88 QYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCL 152
            |.| :....|.|  |....:|...|||:|..: ...|.:     .:.|.|:::.||.:||.|||:
Mosquito   227 QLN-LNGVVQRT--INEDFRAEYGEFPWMVAL-FQLPEQ-----RYCCNGALIDPKAILTTAHCV 282

  Fly   153 ETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALV-QDFRVVNYVVHPGYDTEDEEQGFKNDI 216
            .....:|..:         :||.||.:.:||.:.|:. :|..|.:...||.|    ......|:|
Mosquito   283 TNCGGRAANI---------MVRFGEWNMSSTHEMAIPREDIGVKSVHQHPRY----SPSALLNNI 334

  Fly   217 ALVELDRKAEFNDHVAAVCLPPDSGND----VQQVTAAGWG-FTADGVKSSHLLK-VNLQRFSDE 275
            |::||....::...:..||||  |.|.    ::.:.|.||| ...:....:.:|| ::|||....
Mosquito   335 AVLELAHPVQYQATIQPVCLP--SANQPLRAMENMIATGWGRVMEENAPPTQILKRLDLQRMEPS 397

  Fly   276 VCQKRLR-------FSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLV 333
            :|::.||       |.:|:.......:...|...|:||:|.|:.|:.|.......:.|:||:|..
Mosquito   398 ICREALRRVRRPYPFILDSSFVCSTTNHGDQERPCDGDAGAPVVVELPGTTNRYYLHGLVSWGYG 462

  Fly   334 CGSQGLP-SVYTKVHLYTDWIESIVWG 359
            |..:.:| :|.|||..:.:||:.||.|
Mosquito   463 CHQKQIPYTVLTKVVHFREWIDRIVLG 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 74/268 (28%)
Tryp_SPc 102..353 CDD:214473 72/265 (27%)
CLIPA2XP_320727.4 Tryp_SPc 244..486 CDD:238113 73/262 (28%)
Tryp_SPc 244..483 CDD:214473 71/259 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.