DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP011793

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_320722.4 Gene:AgaP_AGAP011793 / 1280855 VectorBaseID:AGAP011793 Length:426 Species:Anopheles gambiae


Alignment Length:420 Identity:118/420 - (28%)
Similarity:166/420 - (39%) Gaps:100/420 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLIASVSVVTEYCDNGTGECKELTPSDCPVI-FYNQHLIGAEVKYCDEFNDI-VCCPIPLDHQN 72
            |||....|...:.||.  |||..:|......: .:..::|...:...||.:.: .|||.|.|..:
Mosquito    14 LLLAHGESEKAKPCDG--GECVPVTKCKSGELEDHGAYVISLRLNPEDECSYLETCCPYPKDEDD 76

  Fly    73 ---------LK--------------PAEQTRPFEKQ------CKQYNEVRS------------AC 96
                     ||              .|||......|      ....|.|:|            |.
Mosquito    77 ESRDELGELLKAPATGNGAGEALNVAAEQVPSVAAQRANLLSSSGANNVKSENLKAATNRPPTAS 141

  Fly    97 QSTPFIVGGTKASG---------------KEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVL 146
            .:.|...|...::|               .|||:||.|...:....:....:.||||::||..:|
Mosquito   142 ATGPQTCGVRNSNGVQFRITDDSDGESEYGEFPWMAAILEEQKALDQIINTYMCGGSLIHPSVIL 206

  Fly   147 TAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQG 211
            |||||::           |.......|||||.|..|..:....||.|||....|        ||.
Mosquito   207 TAAHCVQ-----------NITITALKVRLGEWDTRSWKEPFPHQDRRVVEIAFH--------EQF 252

  Fly   212 FK----NDIALVELDRKAEFNDHVAAVCLPPDSGN-DVQQVTAAGWG---FTADGVKSSHLLKVN 268
            |.    |::||:.||:..|..:.|..:||||.:.. |..:..|:|||   |..:|:..:.|.||.
Mosquito   253 FAPAALNNVALLFLDKPVELMETVNTICLPPANYTFDPVRCVASGWGKDVFGNEGMFQAILKKVE 317

  Fly   269 LQRFSDEVCQKRLRFSIDTR---------TQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQV 324
            |.......||:.||.   ||         :..|||....: |||.||.|.|:....|........
Mosquito   318 LPLMPRGACQRALRM---TRLGRRFKLHESFLCAGGEKGR-DTCKGDGGSPLVCPIPGVANGYYQ 378

  Fly   325 IGIVSYGLVCGSQGLPSVYTKVHLYTDWIE 354
            ..||::|:.||.:|:|.||..|.|:.:||:
Mosquito   379 ASIVAWGINCGIEGVPGVYVNVALFREWID 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 89/285 (31%)
Tryp_SPc 102..353 CDD:214473 87/282 (31%)
AgaP_AGAP011793XP_320722.4 Tryp_SPc 167..410 CDD:238113 87/265 (33%)
Tryp_SPc 167..407 CDD:214473 85/262 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.