DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP011908

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_320621.4 Gene:AgaP_AGAP011908 / 1280755 VectorBaseID:AGAP011908 Length:391 Species:Anopheles gambiae


Alignment Length:272 Identity:82/272 - (30%)
Similarity:118/272 - (43%) Gaps:60/272 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 TPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLET--DESKAER 161
            |..||||:.|...|  :.|::|...|    ..:|..|.|:::..::|||||||..|  ..|:.:.
Mosquito   151 TAKIVGGSVAGVNE--YTAMVGLLDP----LTVNVFCSGAIISSRYVLTAAHCARTIPSVSRVQA 209

  Fly   162 LDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAE 226
            |            :|:.||.|..|......:.:...:.|..|:    ||...|||||::...:.:
Mosquito   210 L------------VGDHDYRSGLDTPYSAIYNIEQIISHEYYN----EQTRNNDIALLKTSTEMD 258

  Fly   227 FNDHVAAVCLP-----PDSGNDVQQVTAAGWGFTA-DGVKSSHLLKVNLQRFSDEVC-------Q 278
            ||..|..:|||     ...|.  ..|..||||.|: .|..|:.|.|..|....:..|       |
Mosquito   259 FNRGVGPICLPFTYSTYSFGG--LSVDIAGWGTTSFGGPMSTILRKTTLNVLQNANCTAPYVNDQ 321

  Fly   279 KRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQ--HPLYPCLKQVIGIVSYGLVCGSQGLPS 341
            |...|::.             .|:|..||||.:|::  ..:|.     |||:|||..|.: ..||
Mosquito   322 KICTFAVG-------------RDSCQYDSGGALFLRGSQRMYS-----IGIISYGSACAA-STPS 367

  Fly   342 VYTKVHLYTDWI 353
            |.|:|..|..||
Mosquito   368 VATRVTAYLSWI 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 81/269 (30%)
Tryp_SPc 102..353 CDD:214473 79/267 (30%)
AgaP_AGAP011908XP_320621.4 CUB 26..>106 CDD:294042
Tryp_SPc 153..379 CDD:214473 79/268 (29%)
Tryp_SPc 154..382 CDD:238113 81/269 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.