DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP012328

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_320219.3 Gene:AgaP_AGAP012328 / 1280372 VectorBaseID:AGAP012328 Length:324 Species:Anopheles gambiae


Alignment Length:330 Identity:111/330 - (33%)
Similarity:155/330 - (46%) Gaps:82/330 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 CDEFNDIVC---------CPIPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASG 110
            ||....:.|         |.:.:|::                              ||||.:.|.
Mosquito    37 CDRRKGLTCRTGSVNDEVCGVQMDNR------------------------------IVGGQRTSI 71

  Fly   111 KEFPFMALIG--THRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVV 173
            .::|:|||:.  .||    |....:.|||::::.||||:||||.       .||....:..|  |
Mosquito    72 DQYPWMALLQYINHR----KGTKRFACGGALLNRKFVLSAAHCF-------VRLPAGVELHK--V 123

  Fly   174 RLGELDYNS-----TTDDAL-----VQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFN 228
            ||||.|.:|     ..||.|     |||......::|.||.....::  :|||||:||...|::|
Mosquito   124 RLGEWDTDSEIDCEDLDDELSCASPVQDLDYERIIIHEGYTGNHADR--ENDIALIELSGSAKYN 186

  Fly   229 DHVAAVCLP-PDSGNDVQ----QVTAAGWGFTADGVKSSHLLKVNLQRFSDEVC----QKRLRFS 284
            |.|..:||| |.:.|..:    .:.|||||.|.....|...|.|.|..|..:.|    |:|::..
Mosquito   187 DFVKPICLPEPGTPNKEKLYFGSMWAAGWGRTETASGSRFKLYVPLDLFDLQSCNETYQRRVKVP 251

  Fly   285 IDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYG-LVCGSQGLPSVYTKVHL 348
            : |.|||||.....: ||||||||||:.   .....|..|:|:||:| ..||| |:|:|||:|..
Mosquito   252 L-TETQFCAMGTPGK-DTCNGDSGGPLM---KTMKTLHYVVGVVSFGPQRCGS-GIPAVYTRVDK 310

  Fly   349 YTDWI 353
            :.|||
Mosquito   311 FYDWI 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 106/274 (39%)
Tryp_SPc 102..353 CDD:214473 104/272 (38%)
AgaP_AGAP012328XP_320219.3 CLIP 1..45 CDD:295450 2/7 (29%)
Tryp_SPc 62..315 CDD:214473 104/303 (34%)
Tryp_SPc 63..315 CDD:238113 104/272 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.