DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP009273

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_320067.4 Gene:AgaP_AGAP009273 / 1280238 VectorBaseID:AGAP009273 Length:308 Species:Anopheles gambiae


Alignment Length:302 Identity:96/302 - (31%)
Similarity:132/302 - (43%) Gaps:71/302 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 FEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSK--------SDINWDCGGS 138
            ::.||              .|.|||:.:..|||.||::|.......:        :.:.|.||||
Mosquito    50 YDSQC--------------LIFGGTQVNVTEFPHMAVLGWKVEELGEGADSGDDGAGVRWQCGGS 100

  Fly   139 VVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGY 203
            ::..:||||||||         ..|.| :.|..:||||:::..||.|||..|.|.::..|.||  
Mosquito   101 LITLRFVLTAAHC---------AADAN-NIPPRLVRLGDVNLASTKDDAYAQQFDILRIVRHP-- 153

  Fly   204 DTEDEEQGFKN---DIALVELDRKAEFNDHVAAVCLPPDSG-NDVQQVTAAGWG-FTADGVKSSH 263
                 |..|..   |:||||||......:.|...||..:|. ...|....||:| .|..|.....
Mosquito   154 -----EHRFSRKYFDLALVELDGVVRLTEGVCPTCLWTNSKVLPAQFFQTAGFGEITLGGGSVPT 213

  Fly   264 LLKVNLQRFSDEVCQKRLRFSIDTR--------TQFCAGSMSSQADTCNGDSGGPIFV------- 313
            |||..|.......|.:..::   ||        .|.||..::  ||||.||||||:.|       
Mosquito   214 LLKTALSATDSTECSESFKY---TRGLPEGIRHDQVCASMLN--ADTCQGDSGGPLQVSLRSYST 273

  Fly   314 QHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIES 355
            :||.      ::.:.|:|..||. |...||.:|..:..||||
Mosquito   274 EHPF------LVALTSFGRGCGI-GSSGVYQQVAAHIPWIES 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 94/282 (33%)
Tryp_SPc 102..353 CDD:214473 90/278 (32%)
AgaP_AGAP009273XP_320067.4 Tryp_SPc 56..308 CDD:238113 92/280 (33%)
Tryp_SPc 56..306 CDD:214473 90/278 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.