DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CLIPB16

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_320055.4 Gene:CLIPB16 / 1280226 VectorBaseID:AGAP009263 Length:406 Species:Anopheles gambiae


Alignment Length:363 Identity:102/363 - (28%)
Similarity:150/363 - (41%) Gaps:80/363 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GTGECKELTPSDCPVIFY---NQHLIGAEVKYC--DEFNDIVCCPIPLDHQNLKPAEQTRPFEKQ 85
            |..||..|  ::||.:..   .|...|.....|  :|:...||||..:          |.|    
Mosquito    84 GLTECVPL--AECPELLLEISRQCYRGDFSLSCGVNEYEPHVCCPRVV----------TSP---- 132

  Fly    86 CKQYNEVRSACQSTPFIVGGTKASG-KEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAA 149
              .:|:.|:.......||.|...:| ..:||:|.||.  .|.......:.|.||::..:.|||:|
Mosquito   133 --TFNDQRAPAACGKSIVQGDFYNGLGAYPFVARIGF--KNTKTGTFIFPCSGSIIARQIVLTSA 193

  Fly   150 HCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDD---------ALVQDFRVVNYVVHPGYDT 205
            || ...::::.||..        ||:|  ||::.||.         .:..:..|...:|||.|  
Mosquito   194 HC-ALAKAESHRLSS--------VRVG--DYDTRTDPDCGSTGFCAPVAINHAVSQIIVHPDY-- 245

  Fly   206 EDEEQGFKNDIALVELDRKAEFNDHVAA--VCLPPDS-----GNDVQQVTAAGWG-FTADGVKSS 262
              .|..:.:||||:.|  :...|..|||  :||....     |..||.:   ||| .:....||.
Mosquito   246 --IEGQYHHDIALLIL--RTPINYTVAAQPICLHARKQDLTVGRRVQII---GWGKLSTSAAKSP 303

  Fly   263 HLLKVNLQRFSDEVCQKRLRF--------SIDTRTQFCAGSMSSQADTCNGDSGGPIFVQ-HPLY 318
            .|..:.:...|.:.|.:....        |||.. ..|||  ....|.|:|..|.|:.:: ...|
Mosquito   304 ELQSLEVPLTSWDKCVRAYASTGALQSPQSIDGE-WMCAG--GEGRDACHGFGGAPLIIRDQGRY 365

  Fly   319 PCLKQVIGIVSYGL-VCGSQGLPSVYTKVHLYTDWIES 355
                ..|||:|:|. .||:..:|||||.:..|..|||:
Mosquito   366 ----AQIGIMSFGAETCGALNMPSVYTSIAHYAPWIEA 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 84/282 (30%)
Tryp_SPc 102..353 CDD:214473 81/278 (29%)
CLIPB16XP_320055.4 CLIP 88..126 CDD:295450 10/39 (26%)
Tryp_SPc 157..400 CDD:238113 80/272 (29%)
Tryp_SPc 157..397 CDD:214473 77/268 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.