DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP009252

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_320033.4 Gene:AgaP_AGAP009252 / 1280210 VectorBaseID:AGAP009252 Length:460 Species:Anopheles gambiae


Alignment Length:384 Identity:91/384 - (23%)
Similarity:146/384 - (38%) Gaps:134/384 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VTEYCDNGTGECKELTPSDCPVIFYNQHLIGAEVKYCDEFNDIVCCPIPLDHQNLKPAEQTRPFE 83
            :..:.|...|.|...|  .||.|.|: ..:...|.:| :.:.:||||    ::|:          
Mosquito   164 ICRHVDGAEGLCVGAT--RCPKIRYD-FSVNRRVVFC-QTSTVVCCP----YENM---------- 210

  Fly    84 KQCKQYNEVRSACQSTPFIVGGTKASGKEF--------------------------PFMALIGTH 122
                               |..|.|||:|.                          |::..:|..
Mosquito   211 -------------------VNETTASGRELDECAHRIKASSGSTNEAQFETGYISEPYLVEVGWR 256

  Fly   123 RPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDA 187
            ....:|:  .|.|.|:::..|.|||:|.||:     .:.:.|:      |:|||           
Mosquito   257 GNGDAKA--QWSCRGTLITSKAVLTSAKCLQ-----QQSIAPS------VIRLG----------- 297

  Fly   188 LVQDFRVVNY---VVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAV---CLPPDSGND--- 243
            |.:...|||.   ::||.:|....    ||:|||:::  |...:....|:   ||..:..:.   
Mosquito   298 LNEAAPVVNVEETILHPEFDVASG----KNNIALIKM--KDAIDQSTIAINPACLWKNQTHTPFE 356

  Fly   244 -VQQVTAAGWGFTADGVKSSHL-LKVNLQRFSDEVCQKRLRFSIDTRTQFCAG-SMSSQADTCNG 305
             :|.|           :|.|.| ..:...:|:.: |.:..|.::|.. :.|.. ......||  |
Mosquito   357 MIQPV-----------IKESTLGPALAFTKFNSD-CDRTFRRTLDEH-ELCVDVEQLPYMDT--G 406

  Fly   306 DSGGPIFVQ--H-----PLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIV 357
            ||||.:.|:  |     |.      |:.:.|:|..|| |..|.|||||..|..||.|::
Mosquito   407 DSGGRLQVKLLHNAKVTPF------VVAVTSFGSACG-QSTPGVYTKVSKYAPWIRSVI 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 75/298 (25%)
Tryp_SPc 102..353 CDD:214473 73/295 (25%)
AgaP_AGAP009252XP_320033.4 Tryp_SPc 248..457 CDD:304450 69/260 (27%)
Tryp_SPc 248..454 CDD:214473 67/257 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.