DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP009249

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_320028.4 Gene:AgaP_AGAP009249 / 1280205 VectorBaseID:AGAP009249 Length:776 Species:Anopheles gambiae


Alignment Length:264 Identity:86/264 - (32%)
Similarity:126/264 - (47%) Gaps:53/264 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 RPNKSKSD---------------INWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFV 172
            ||::..||               :.|:|.|::|...|:||:|.|  |.:.|...:        :|
Mosquito    22 RPHQKMSDFSHLGRIGWTGIDGTVRWNCSGTLVWENFILTSARC--TTDGKYVTI--------YV 76

  Fly   173 VRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLP 237
            .|.|:||..:.|||...|..::|..:.||.:...|.    .:||||:.|:||...:|.||..||.
Mosquito    77 ARFGDLDLFNATDDQYAQQLKIVEIIRHPEHRHRDR----YHDIALMRLERKVVLHDTVAPACLW 137

  Fly   238 PDSGNDVQQVTAAGWGFTA-DGVKSSHLLKVNLQRFSDEVCQKR------LRFSIDTRTQFCAGS 295
            .|.....::..|.|||.|. ...|:..||||.|...::|.|.:.      ||..:.. .|.||| 
Mosquito   138 TDDEIRFKRFEATGWGDTGFAAAKTPILLKVALSPVANEQCNEHYSNLRGLRNGLHA-NQLCAG- 200

  Fly   296 MSSQADTCNGDSGGPIFV-------QHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
             .::.|||.||||||:.|       :.|.      ::|:.|:||.|| ..:|.|||:|..|..||
Mosquito   201 -DARMDTCPGDSGGPLQVKLLHNTRETPF------LVGVTSFGLACG-LSVPGVYTRVAPYVPWI 257

  Fly   354 ESIV 357
            .|::
Mosquito   258 RSVL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 85/261 (33%)
Tryp_SPc 102..353 CDD:214473 83/258 (32%)
AgaP_AGAP009249XP_320028.4 Trypsin 43..257 CDD:278516 79/237 (33%)
Tryp_SPc 46..260 CDD:238113 81/237 (34%)
Tryp_SPc 312..552 CDD:304450
Tryp_SPc 654..>751 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.