DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CLIPD7

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_319747.4 Gene:CLIPD7 / 1279958 VectorBaseID:AGAP008998 Length:413 Species:Anopheles gambiae


Alignment Length:325 Identity:83/325 - (25%)
Similarity:130/325 - (40%) Gaps:97/325 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 CPIPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSK 128
            |.||...||        ..:|:                |:||..|:..|:|:.|.|..       
Mosquito   155 CGIPQTSQN--------TLQKR----------------IIGGRTANFAEYPWQAHIRI------- 188

  Fly   129 SDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNST---TDDALVQ 190
              ..:.|||.:|..:||.|||||::....|           ..::.|||||..::   .:....:
Mosquito   189 --AEYQCGGVLVSRRFVATAAHCIQQARLK-----------DILIYLGELDTQNSGKIVEPLPAE 240

  Fly   191 DFRVVNYVVHPGY---DTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDV-QQVTAAG 251
            ..||...:|||.:   .|:.:    :.|:||::|.|.|.:..|:..:|||......| ::...||
Mosquito   241 KHRVEMKIVHPKFIFRMTQPD----RYDLALLKLTRPAGYKSHILPICLPMRPLELVGRKGIIAG 301

  Fly   252 WGFTAD--GVKSSHLLK--------------------VNLQRFSDEVCQKRLRFSIDTRTQFCAG 294
            ||.|..  |...:::|:                    :|::.|::               .||||
Mosquito   302 WGKTNANMGQTGTNILRTAAVPIISTKECLRWHSSKNINVELFNE---------------MFCAG 351

  Fly   295 SMSSQADTCNGDSGGPIFV-QHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIVW 358
            ......|.|.||||||:.: ....|    .:|||.|.|..||....|.:|..|.....||:|:::
Mosquito   352 HSDGHQDACLGDSGGPLIINDRGRY----TLIGITSAGFGCGVDHQPGIYHNVQKTIKWIQSVIY 412

  Fly   359  358
            Mosquito   413  412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 76/283 (27%)
Tryp_SPc 102..353 CDD:214473 74/280 (26%)
CLIPD7XP_319747.4 Tryp_SPc 168..407 CDD:214473 74/297 (25%)
Tryp_SPc 169..410 CDD:238113 76/283 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.