DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG43336

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:295 Identity:88/295 - (29%)
Similarity:131/295 - (44%) Gaps:78/295 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 VRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDE 156
            :|:...|.|.:..||.||....|:||.:       ..:|..:.||||::..:.|||||||.    
  Fly    28 IRAHSPSVPRVKNGTVASLTSSPWMAFL-------HSTDGRFICGGSLITNRLVLTAAHCF---- 81

  Fly   157 SKAERLDPNFDSPKFVVRLGELD---YNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKN---- 214
                     .|..:.|.||||.|   |....|....  :|:...|          |:||::    
  Fly    82 ---------LDRTELVARLGEYDREEYEMCHDSYCT--YRIEAMV----------ERGFRHRHYN 125

  Fly   215 ------DIALVELDRKAEFNDHVAAVCLPPDSG-----NDVQQVTAAGWGFTADGVKSSHLLKVN 268
                  |||::.|.||.::.|::..:|:..|..     :.:..:|..|||.|.....|:.|..|:
  Fly   126 PMTMAYDIAILRLYRKVQYTDNIRPICIVIDPRWRKYIDSLDPLTGTGWGKTESEGDSAKLRTVD 190

  Fly   269 LQRFSDEVCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPI-----------FVQHPLYPCLK 322
            |.|...|||::....|: |..|||||  :.:::.||||||||:           |||        
  Fly   191 LARKHPEVCRRYATLSL-TANQFCAG--NERSNLCNGDSGGPVGALIPYGKSKRFVQ-------- 244

  Fly   323 QVIGIVSY-GLVCGSQGLPSVYTKVHLYTDWIESI 356
              :||.|: ...|   .:.||:|.|..|.|||.::
  Fly   245 --VGIASFTNTQC---VMVSVFTDVMSYVDWILAV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 85/283 (30%)
Tryp_SPc 102..353 CDD:214473 83/280 (30%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 83/281 (30%)
Tryp_SPc 40..271 CDD:238113 83/278 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.