DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG43124

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:316 Identity:68/316 - (21%)
Similarity:114/316 - (36%) Gaps:112/316 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 IVCCPIPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKEF-PFMALIGTHRP 124
            ||.|.:.:.:|.   :.||  .|:.|..:.|               :.:|..: |::|.|     
  Fly     7 IVLCIVLMFYQG---SAQT--LEEDCVDHME---------------RINGSSYAPWLAEI----- 46

  Fly   125 NKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALV 189
               .||....|.|::::..:|||||.|.:.:|             |..||||     |...|...
  Fly    47 ---LSDSKVICAGALINNLYVLTAASCFKENE-------------KLTVRLG-----SGYFDKSY 90

  Fly   190 QDFRVVN---YVVH-PGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCL---PPDSG------ 241
            ::|||..   ::.| |..:|        |::.:..|..:.||..|:..:|:   |...|      
  Fly    91 ENFRVTKAYFWMTHFPANNT--------NNLCIFRLQTEVEFKTHIRPMCITKSPKSLGLATTFE 147

  Fly   242 --NDVQQVTAAGWGFTAD--GVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQFCAGSMSSQADT 302
              |:..::    |.|..:  |:...::...|     :|..|.:...|..|.|             
  Fly   148 IINEKPKM----WYFCKNIKGLFCKYVFGEN-----EEKWQSKPTGSPWTET------------- 190

  Fly   303 CNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVC--GSQGLPSVYTKVHLYTDWIESI 356
               .|.||.             .|:|.||::.  .::....||..|..:.:||..|
  Fly   191 ---ISNGPF-------------KGLVRYGILSYRDNKTYDEVYINVMSHINWIAQI 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 58/273 (21%)
Tryp_SPc 102..353 CDD:214473 56/270 (21%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 32/125 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.