DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP009849

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_318962.4 Gene:AgaP_AGAP009849 / 1279267 VectorBaseID:AGAP009849 Length:356 Species:Anopheles gambiae


Alignment Length:353 Identity:92/353 - (26%)
Similarity:141/353 - (39%) Gaps:99/353 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ECKELTPSD--CPVIFYNQHLIGAEVKYCDEFNDIVCCPIPLDHQNLKPAEQTRPFEKQCKQYNE 91
            |.|:|.|:.  |..:|.:....|...:|.|||:                      |:.:..|.: 
Mosquito    68 ENKDLRPTHPVCCAVFQSDQTCGRLSQYADEFS----------------------FDSRETQLD- 109

  Fly    92 VRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDE 156
                                :||:.|::...|..|..      |.||::..:|||:||||.    
Mosquito   110 --------------------QFPWAAMVLLRRVQKLV------CSGSLIASRFVLSAAHCF---- 144

  Fly   157 SKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQ-----------DFRVVNYVVHPGYDTEDEEQ 210
                 :|....:..:.||||:.|.....|...|:           |:.|...:.|.  |.:.:.:
Mosquito   145 -----VDVRGTTTDYRVRLGDWDLELDEDCLYVRGQLVCNEQQPVDYAVERIISHG--DFQRQRR 202

  Fly   211 GFKNDIALVELDRKAEFNDHVAAVCLPP-DSGNDV---QQVTAAGWGFTA--DGVKSSHLLKVNL 269
            .|.:||||::|....|:...:...|||. :.|..:   |:.|..|||.|.  .||:..:.:::..
Mosquito   203 DFLHDIALLKLAEAVEYGAQIGPACLPNWNVGVPLIAGQKFTVFGWGRTRSYSGVRRKYKIEMPG 267

  Fly   270 QRFSDEVCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPI-------FVQHPLYPCLKQVIGI 327
            :..|..|....||.....|...|.|.: .:.|.|:|||||.:       :||.          ||
Mosquito   268 RNISACVRAYGLRAPEVPRIHLCVGGV-YRKDVCHGDSGGALMRRESNRWVQE----------GI 321

  Fly   328 VSYGLV-CGSQGLPSVYTKVHLYTDWIE 354
            ||:|.. || :.||.|||.|..|.|||:
Mosquito   322 VSFGAYRCG-KPLPGVYTNVAHYIDWIQ 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 79/278 (28%)
Tryp_SPc 102..353 CDD:214473 77/275 (28%)
AgaP_AGAP009849XP_318962.4 Tryp_SPc 104..348 CDD:238113 79/293 (27%)
Tryp_SPc 104..347 CDD:214473 78/292 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.