DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CLIPB15

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_318957.5 Gene:CLIPB15 / 1279262 VectorBaseID:AGAP009844 Length:364 Species:Anopheles gambiae


Alignment Length:353 Identity:103/353 - (29%)
Similarity:153/353 - (43%) Gaps:83/353 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VKYCDEFNDIVCCPIPLDH------QNLKPAEQTRPFEKQ------CKQYNE--VRSACQSTPFI 102
            ||.|.....|:..| ...|      ..||..:...|..|:      |.:::.  ...|.|....|
Mosquito    44 VKNCSYVRKILKSP-DFSHYDTTYLDTLKCGDLMVPMRKKPIPLLCCPKFSNSPTCGAQQLADRI 107

  Fly   103 VGGTKASGKEFPFMAL----IGTHR--PNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAER 161
            ..|.:......|:.||    :|.:|  |.         |||:::..::|:|||||          
Mosquito   108 YFGEETERGAHPWAALLFYNVGRNRTVPK---------CGGALISERYVITAAHC---------- 153

  Fly   162 LDPNFDSPKF---VVRLGELDYNS-----TTDDALV--QDFRVVNYVVHPGYDTEDEEQGFKNDI 216
               ..|.|.:   .||..|.:.:|     |.:|.::  :|:.|.:.|.||.||..:..:  .|||
Mosquito   154 ---TVDKPNWKLLYVRFNEFNTSSADNCTTENDEVICREDYAVESIVPHPEYDMHNISR--PNDI 213

  Fly   217 ALVELDRKAEFNDHVAAVCLPPDSGNDVQQV-------TAAGWGFTADGVKSSHLLKVNLQRFSD 274
            .::.|.....|||:|..:|||.|.  ||||:       |..|||.|.|...|.....|.|.....
Mosquito   214 CILRLASDVTFNDYVRPICLPFDP--DVQQLPIVDEIFTVTGWGETEDRRPSDTQKHVELPGLEH 276

  Fly   275 EVCQKRLRFSIDTRT--QFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQV------IGIVSYG 331
            |.|......:..|.:  |.|.|.::. :|:|.||||||:         :::|      ||:||:|
Mosquito   277 EACNSVYAVANVTLSDKQLCIGGLNG-SDSCRGDSGGPL---------MREVRGGWFLIGVVSFG 331

  Fly   332 L-VCGSQGLPSVYTKVHLYTDWIESIVW 358
            . .||:|.||.|||.|..|.||:|::::
Mosquito   332 ARFCGTQNLPGVYTNVAKYLDWMETVMF 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 90/285 (32%)
Tryp_SPc 102..353 CDD:214473 88/282 (31%)
CLIPB15XP_318957.5 CLIP 31..90 CDD:197829 10/46 (22%)
Tryp_SPc 110..353 CDD:238113 86/278 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.