DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP003971

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_318423.5 Gene:AgaP_AGAP003971 / 1278791 VectorBaseID:AGAP003971 Length:263 Species:Anopheles gambiae


Alignment Length:288 Identity:78/288 - (27%)
Similarity:124/288 - (43%) Gaps:91/288 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 TPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWD---CGGSVVHPKFVLTAAHCLETDESKAE 160
            :|.|.||..|:..:|||...:           ||..   |||:||:.:::||||.|: |.::.: 
Mosquito    34 SPRIAGGEDAADGQFPFQVAL-----------INEGLVYCGGTVVNRRWILTAAACI-TGKALS- 85

  Fly   161 RLDPNFDSPKFVVRLGELD-----YNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVE 220
                  |...||   |..|     .|.|.:          .:|:||.::.    |.:.||||||.
Mosquito    86 ------DVQLFV---GSADRLTGGRNVTAE----------RFVIHPDFNA----QTYANDIALVR 127

  Fly   221 LDRKAEFNDHVAAVCLPPDSGNDVQQV-------------TAAGWGFTADGVKSSHLLKVNLQRF 272
            :.....|            :||::|.:             |.:|||..|   .|::.|...||..
Mosquito   128 MAESLAF------------TGNELQPIRLATDFFETATNATVSGWGRFA---ISNNQLPNRLQFI 177

  Fly   273 SDEV-----CQKRL----RFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIV 328
            ..:|     |.::.    |..|..|| .|..:.::|. .|.||:|||:.:.       .:::|:.
Mosquito   178 RTDVIGSEDCAEQFEEPYRSRISDRT-ICTSNQANQG-VCLGDAGGPLVLD-------GELVGVQ 233

  Fly   329 SYGLVCGSQGLPSVYTKVHLYTDWIESI 356
            |:.:.||: |||.||.:|..:..||.:|
Mosquito   234 SWSIPCGT-GLPDVYERVSHHRAWILAI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 76/283 (27%)
Tryp_SPc 102..353 CDD:214473 74/280 (26%)
AgaP_AGAP003971XP_318423.5 Tryp_SPc 36..257 CDD:214473 74/281 (26%)
Tryp_SPc 37..257 CDD:238113 74/280 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.