DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP003960

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_318412.5 Gene:AgaP_AGAP003960 / 1278781 VectorBaseID:AGAP003960 Length:579 Species:Anopheles gambiae


Alignment Length:280 Identity:70/280 - (25%)
Similarity:120/280 - (42%) Gaps:63/280 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPF-MALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDES--KAERLD 163
            |..|.::...::|: :||.     :.::....:.||||::....:|||||||.....  ..||| 
Mosquito    39 ITNGLESKEGDWPWHVALF-----HNNRRSFEYACGGSILDQNTILTAAHCLWLSNGLIAKERL- 97

  Fly   164 PNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFN 228
                    :|::|.......:..|  :|......:|||.|:...    ..|||||::|.....|.
Mosquito    98 --------LVQVGRSRLRVASIHA--RDHEAYELIVHPKYNVNQ----IANDIALIKLATDITFT 148

  Fly   229 DHVAAVCLPPDSGNDVQQV-----TAAGWGF-----TADGVKSSHL--------LKVNLQRFSDE 275
            :.|..:|| .:.|:|...:     |..|:|:     ..|.::.:.|        ::.|.:.|:.:
Mosquito   149 NFVQPICL-WNRGDDQSSIVGTLGTVIGFGYDETDNPTDTLREARLPVVSAIDCIQSNREAFATQ 212

  Fly   276 VCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSY------GLVC 334
            :          |...||||..:. ...|||||||.:|..   :..:..:.|:||:      ..:|
Mosquito   213 L----------TSDMFCAGYRNG-TSPCNGDSGGGLFFN---FNNVWYIRGLVSFTKPRQDTTIC 263

  Fly   335 GSQGLPSVYTKVHLYTDWIE 354
            .::.. :|:|.|..|..|||
Mosquito   264 DTKEY-TVFTDVAKYLRWIE 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 70/280 (25%)
Tryp_SPc 102..353 CDD:214473 67/277 (24%)
AgaP_AGAP003960XP_318412.5 Tryp_SPc 39..283 CDD:238113 70/280 (25%)
Tryp_SPc 39..281 CDD:214473 67/277 (24%)
Tryp_SPc 331..573 CDD:214473
Tryp_SPc 331..573 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.