DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP004770

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_318046.3 Gene:AgaP_AGAP004770 / 1278456 VectorBaseID:AGAP004770 Length:259 Species:Anopheles gambiae


Alignment Length:269 Identity:80/269 - (29%)
Similarity:125/269 - (46%) Gaps:47/269 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 QSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAER 161
            ::|..||||.:......||.|.:.:|..:.        ||||::|.::||:|.||    .||   
Mosquito    26 ETTQRIVGGHEIDIGAAPFQASVQSHGVHV--------CGGSIIHQQWVLSAGHC----SSK--- 75

  Fly   162 LDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNY---VVHPGYDTEDEEQGFKNDIALVELDR 223
             :||    ...||:..:.:|        |..::||.   :.||.|   ||:.....|::|:.|::
Mosquito    76 -EPN----SLSVRVASIHHN--------QGGQIVNVEESIRHPLY---DEQLIIDYDVSLLRLEQ 124

  Fly   224 KAEFNDHVAAVCLP--PDSGNDVQQVTAAGWGFTADGVKSSHLLK-VNLQRFSDEVCQKRLRFSI 285
            ...|:.:|.|:.||  .:...|......:|||.|.:.|:||..|: .::...:..|||.....:.
Mosquito   125 CLTFSPNVQAIRLPMQDEFFQDGTVCVVSGWGATQNPVESSDRLRATDVPLVNHAVCQTAYISAA 189

  Fly   286 DTRT--QFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGL-VCGSQGLPSVYTKVH 347
            .|.|  ..|||..|...|.|.||||||::.::.|       ||:||:.. .|.....|.||::|.
Mosquito   190 ATITDRMICAGYFSGGRDACQGDSGGPLYYENTL-------IGVVSWRTGDCAEVNFPGVYSRVA 247

  Fly   348 LYTDWIESI 356
            ....||..:
Mosquito   248 SVRAWIYEV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 79/262 (30%)
Tryp_SPc 102..353 CDD:214473 77/259 (30%)
AgaP_AGAP004770XP_318046.3 Tryp_SPc 30..253 CDD:214473 77/260 (30%)
Tryp_SPc 31..256 CDD:238113 79/262 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.