DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP011477

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_317829.4 Gene:AgaP_AGAP011477 / 1278364 VectorBaseID:AGAP011477 Length:276 Species:Anopheles gambiae


Alignment Length:315 Identity:91/315 - (28%)
Similarity:139/315 - (44%) Gaps:58/315 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 HLIGAEVKYCDEFNDIVCCPIPLDHQNLK--PAEQTRPFEKQCKQYNEVRSACQSTPFIVGGTKA 108
            |.:.:.|..|      ||....:.|..::  |.::|.|.   || |..:..|     .:|||:..
Mosquito     9 HRMKSLVALC------VCAMSLVSHHTVRSSPIKRTSPI---CK-YGLINMA-----RVVGGSDT 58

  Fly   109 SGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVV 173
            :.:..|:.  :...|.:|.      .|||::::...:||||||::..|     |.|:    .|.|
Mosquito    59 TIEAHPYQ--VSLRRLHKH------SCGGAILNTNTILTAAHCVDYPE-----LVPS----DFEV 106

  Fly   174 RLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPP 238
            |.|     ||..:...|...|.....||.|:    :...:.||::::|....:.:..|..:.| |
Mosquito   107 RAG-----STFRNEGGQLITVAQIHTHPSYN----DWTLEWDISVLKLVSSLQLSPTVQPISL-P 161

  Fly   239 DSG---NDVQQVTAAGWG-FTADGVKSSHLLKVNLQRFSDEVCQKRLR-FSIDTRTQFCAGSMSS 298
            |.|   .|...|:.|||| ....|..::||..|.|...|:..|....: |:.......|||....
Mosquito   162 DRGLTIPDGTSVSLAGWGSLYYQGPSTNHLQHVMLPIVSNSRCGMAYKNFAPILPFHICAGHKGK 226

  Fly   299 QADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
              |.|.||||||:..|       .:|:||||:|..|..:..|||||:|..:.|:|
Mosquito   227 --DACQGDSGGPLVYQ-------SRVVGIVSWGYGCAFENYPSVYTRVSEFLDFI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 78/257 (30%)
Tryp_SPc 102..353 CDD:214473 77/255 (30%)
AgaP_AGAP011477XP_317829.4 Tryp_SPc 51..272 CDD:214473 77/256 (30%)
Tryp_SPc 52..272 CDD:238113 77/255 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.