DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and TRY6_ANOGA

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_317175.2 Gene:TRY6_ANOGA / 1277692 VectorBaseID:AGAP008290 Length:273 Species:Anopheles gambiae


Alignment Length:262 Identity:74/262 - (28%)
Similarity:114/262 - (43%) Gaps:51/262 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALI---GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLD 163
            ||||......:.|:...:   |.|.           ||||:::.|::||||||::.         
Mosquito    47 IVGGFVIDISDAPYQISLQYNGKHH-----------CGGSILNSKWILTAAHCIDL--------- 91

  Fly   164 PNFDSPKFVVRLGELDY--NSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAE 226
              :...|..||:|..::  ..|.       ..::..|.|||:.:    .|...||||:||:.:..
Mosquito    92 --YSEVKPTVRVGSSEHAAGGTV-------LHLLRIVPHPGHSS----GGNNYDIALLELECELT 143

  Fly   227 FNDHVAAVCLPPDSGNDVQQVT---AAGWGFTADGVKSSHLLK-VNLQRFSDEVCQKRLR-FSID 286
            |||:|..|.| |:..:.:.:.|   .:|||.|......:.:|: .|:...:.:.|.:..: :...
Mosquito   144 FNDNVQPVQL-PEQDDPIDEGTMGIVSGWGMTMSAADLNAILRATNVPTVNQQECNQAYQSYGGV 207

  Fly   287 TRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTD 351
            ....||||.......||..|||||...:..|       ||:||:...|...|.|.||.:|....|
Mosquito   208 AEQMFCAGYKQGGTGTCRNDSGGPFVAEGKL-------IGVVSWSHECALAGYPGVYARVASVRD 265

  Fly   352 WI 353
            ||
Mosquito   266 WI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 74/262 (28%)
Tryp_SPc 102..353 CDD:214473 72/260 (28%)
TRY6_ANOGAXP_317175.2 Tryp_SPc 46..267 CDD:214473 72/260 (28%)
Tryp_SPc 47..270 CDD:238113 74/262 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.