DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and TRY5_ANOGA

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_317174.2 Gene:TRY5_ANOGA / 1277691 VectorBaseID:AGAP008291 Length:274 Species:Anopheles gambiae


Alignment Length:289 Identity:85/289 - (29%)
Similarity:130/289 - (44%) Gaps:58/289 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 EKQCKQYNEVRSACQSTPF-----IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHP 142
            |::.|....|.....:.|:     ||||...:..:.|:...:        :.|.:.:||||::..
Mosquito    24 ERRHKLTRPVHRFAPNRPYLAGKRIVGGFVINISDAPYQISL--------QYDDDHNCGGSILSS 80

  Fly   143 KFVLTAAHCLETDESKAERLDPNFDSP-KFVVRLGELDYNS--TTDDALVQDFRVVNYVVHPGYD 204
            |::||||||:            |.::| |..||:|...:.|  |.       .||...|.||.: 
Mosquito    81 KWILTAAHCI------------NDNAPSKPTVRVGSSKHASGGTV-------IRVARIVPHPMH- 125

  Fly   205 TEDEEQGFKN--DIALVELDRKAEFNDHVAAVCLPPDSGNDVQQVT---AAGWGFTADGVKSSHL 264
                  |.||  ||||:||..:..|::.|..:.| |:....:::.|   .:|||.|.....|:.:
Mosquito   126 ------GSKNNYDIALLELKNELTFSEKVQPIAL-PEQDEPIEEGTMGIVSGWGLTLSEADSNDV 183

  Fly   265 LK-VNLQRFSDEVCQK--RLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIG 326
            |: .|:...:.:.|.|  :.|:...|...||||......|||..|||||...:..|       ||
Mosquito   184 LRATNVPTVNQQECNKAYQSRYGGITDQMFCAGYKQGGQDTCRQDSGGPFVAKGKL-------IG 241

  Fly   327 IVSYGLVCGSQGLPSVYTKVHLYTDWIES 355
            ::|:|..|...|.|.||.:|....|||.:
Mosquito   242 VISWGHECALAGYPGVYARVASVRDWIRT 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 81/265 (31%)
Tryp_SPc 102..353 CDD:214473 79/261 (30%)
TRY5_ANOGAXP_317174.2 Tryp_SPc 47..268 CDD:214473 79/262 (30%)
Tryp_SPc 48..271 CDD:238113 81/265 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.