DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and TRY4_ANOGA

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_317173.2 Gene:TRY4_ANOGA / 1277690 VectorBaseID:AGAP008292 Length:275 Species:Anopheles gambiae


Alignment Length:297 Identity:88/297 - (29%)
Similarity:129/297 - (43%) Gaps:47/297 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 IVCCPIPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPN 125
            :.|......||...|....|...:.....:..|        ||||.:....|.|:...:     .
Mosquito    16 VACAQAHASHQRRVPYPLPRFLPRPHHTVSNHR--------IVGGFEIDVAETPYQVSL-----Q 67

  Fly   126 KSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQ 190
            :||..|   |||||:..|::||||||  ||.|:...|         .||||...:.|  ..:::.
Mosquito    68 RSKRHI---CGGSVLSGKWILTAAHC--TDGSQPASL---------TVRLGSSRHAS--GGSVIH 116

  Fly   191 DFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLP--PDSGNDVQQVTAAGWG 253
            ..|:|.   ||.||.|..:.    |.:|:||:....|::.|..:.||  .::..|......:|||
Mosquito   117 VARIVQ---HPDYDQETIDY----DYSLLELESVLTFSNKVQPIALPEQDEAVEDGIMTIVSGWG 174

  Fly   254 FTADGVKSSHLLK-VNLQRFSDEVCQKRLRFSID-TRTQFCAGSMSSQADTCNGDSGGPIFVQHP 316
            .|...::|:.:|: .|:...:.:.|.:....|.. |....|||......|.|.||||||:..:..
Mosquito   175 STKSAIESNAILRAANVPTVNQDECNQAYHKSEGITERMLCAGYQQGGKDACQGDSGGPLVAEDK 239

  Fly   317 LYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
            |       ||:||:|..|...|.|.||.:|.:..|||
Mosquito   240 L-------IGVVSWGAGCAQPGYPGVYARVAVVRDWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 82/256 (32%)
Tryp_SPc 102..353 CDD:214473 80/254 (31%)
TRY4_ANOGAXP_317173.2 Tryp_SPc 48..269 CDD:214473 81/263 (31%)
Tryp_SPc 49..272 CDD:238113 82/256 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.