DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and TRY7_ANOGA

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_317172.2 Gene:TRY7_ANOGA / 1277689 VectorBaseID:AGAP008293 Length:267 Species:Anopheles gambiae


Alignment Length:261 Identity:86/261 - (32%)
Similarity:121/261 - (46%) Gaps:44/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPF---MALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLD 163
            ||||.:.:..:.|:   :..|.:||           |||||::.|:|||||||  ||..:|..| 
Mosquito    42 IVGGFEINVSDTPYQVSLQYINSHR-----------CGGSVLNSKWVLTAAHC--TDGLQAFTL- 92

  Fly   164 PNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFN 228
                    .||||...:.|:  ..:|...|:|.   ||.|:    |.....|.||:||:.:..|:
Mosquito    93 --------TVRLGSSRHASS--GTVVNVARIVE---HPKYN----EYNTDYDYALLELESELTFS 140

  Fly   229 DHVAAVCLP-PDSGNDVQQVT-AAGWGFTADGVKSSHLLK-VNLQRFSDEVCQKRLRFSIDTRTQ 290
            |.|..|.|| .|...|...:| .:|||.|....:|:.:|: .|:.....|.|::.......|...
Mosquito   141 DVVQPVALPEQDEAVDAGTMTIVSGWGSTKSATESNAILRAANVPTVDQEECREAYSHDAITDRM 205

  Fly   291 FCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIES 355
            .|||......|.|.||||||:.....|       ||:||:|..|...|.|.||.:|.:..:|:..
Mosquito   206 LCAGYQQGGKDACQGDSGGPLVADGKL-------IGVVSWGSGCAQPGYPGVYARVAVVRNWVRE 263

  Fly   356 I 356
            |
Mosquito   264 I 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 85/259 (33%)
Tryp_SPc 102..353 CDD:214473 84/256 (33%)
TRY7_ANOGAXP_317172.2 Tryp_SPc 41..261 CDD:214473 84/256 (33%)
Tryp_SPc 42..264 CDD:238113 85/259 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.