DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP008403

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_317049.4 Gene:AgaP_AGAP008403 / 1277577 VectorBaseID:AGAP008403 Length:873 Species:Anopheles gambiae


Alignment Length:269 Identity:95/269 - (35%)
Similarity:129/269 - (47%) Gaps:40/269 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 PFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDP 164
            |....|..|..:||..||.:|....|   ..|:|:||||::...:|||||||...|.:.|    |
Mosquito    15 PLPAFGRPAYLREFAHMAAVGWTGEN---GKIDWNCGGSLIWENYVLTAAHCTADDNNAA----P 72

  Fly   165 NFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFK---NDIALVELDRKAE 226
            :      |||||:::.:..:||...|..::|..:.||       |..|.   :|:||:.|:|...
Mosquito    73 D------VVRLGDINLDDDSDDKYAQQLKIVEIIRHP-------EHRFSSRYHDLALLRLERNVT 124

  Fly   227 FNDHVAAVCLPPDSGNDVQQVTAAGWGFTADGVKSSHLLKVNLQRFSDEVCQKR-------LRFS 284
            .:|.||..||..|.......:.|.|||.|. ..|:..||||:|.......|.::       ||..
Mosquito   125 LHDTVAPGCLWNDEEIPFPSMEATGWGSTG-FAKTPILLKVSLSLVPKSTCDQQYRKGDRGLRQG 188

  Fly   285 IDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQ---VIGIVSYGLVCGSQGLPSVYTKV 346
            :.. .|.|||.:  :.|||.||||||:  |..|....|.   :|.:.|:|.||| |..|.||.||
Mosquito   189 LQD-YQLCAGDI--KMDTCPGDSGGPL--QMKLLANAKMTPFIIAVTSFGSVCG-QSTPGVYMKV 247

  Fly   347 HLYTDWIES 355
            ..|..||.|
Mosquito   248 SPYIPWIRS 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 94/267 (35%)
Tryp_SPc 102..353 CDD:214473 91/263 (35%)
AgaP_AGAP008403XP_317049.4 Tryp_SPc 20..256 CDD:238113 93/262 (35%)
Tryp_SPc 20..254 CDD:214473 91/260 (35%)
Tryp_SPc 324..552 CDD:304450
CLIP 577..617 CDD:295450
Tryp_SPc 656..872 CDD:304450
Tryp_SPc 656..869 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.