DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP006677

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_316714.4 Gene:AgaP_AGAP006677 / 1277265 VectorBaseID:AGAP006677 Length:280 Species:Anopheles gambiae


Alignment Length:271 Identity:74/271 - (27%)
Similarity:115/271 - (42%) Gaps:58/271 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESK-----AER 161
            :|||..|:..:||:...:.||    :.......|.||::...:|||||.|:::..|.     ..|
Mosquito    37 VVGGALATAGQFPYAVGLVTH----TGVIFTGRCAGSLISANYVLTAASCVQSATSAFAYLGGLR 97

  Fly   162 LDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAE 226
            :|   |.|:           ...:..|::.|     ::|    |...|.|...|:||..|.|...
Mosquito    98 VD---DQPE-----------QGRERLLIERF-----ILH----TSFVEGGENFDVALGRLPRSVS 139

  Fly   227 FNDHVAAVCLPPDSGNDV------QQVTAAGWGFTADGVKSSHLLKVNLQRF--SDEVCQKRLRF 283
            |:|.:..:.||  :...|      ||.|..|||....|:.:|..|     ||  ::.:.....|.
Mosquito   140 FSDRIRPIRLP--NRRQVQATFAGQQGTVFGWGRFGSGISNSAEL-----RFGRAEIITNLACRV 197

  Fly   284 SIDTRT----QFCA-GSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCG-SQGLPSV 342
            |:.|.|    ..|. ||:||   .|.||:|.|:.:...  ..:...:|:.|:..|.| ..|..:.
Mosquito   198 SLPTNTIGDAHMCTDGSVSS---PCAGDNGAPLTIVDA--DGITTQVGVFSFNSVLGCDAGRAAA 257

  Fly   343 YTKVHLYTDWI 353
            ||::..|.|||
Mosquito   258 YTRLSAYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 74/271 (27%)
Tryp_SPc 102..353 CDD:214473 72/269 (27%)
AgaP_AGAP006677XP_316714.4 Tryp_SPc 36..268 CDD:214473 72/269 (27%)
Tryp_SPc 37..268 CDD:238113 72/269 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.