DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP006674

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_316711.4 Gene:AgaP_AGAP006674 / 1277264 VectorBaseID:AGAP006674 Length:306 Species:Anopheles gambiae


Alignment Length:325 Identity:89/325 - (27%)
Similarity:133/325 - (40%) Gaps:76/325 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 AEVKYCDEFNDIVCCPIPLDH--QNLKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKE 112
            ::||..|||          ||  |.| |||.         ||  :|.|..|.. ||.|.:|:..:
Mosquito    29 SQVKPIDEF----------DHYWQRL-PAEM---------QY--LRHARPSAR-IVNGQQATPGQ 70

  Fly   113 FPF-MALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLG 176
            ||: :||:.........      ||.:::...|:||||||:.....:              |.:|
Mosquito    71 FPYQVALLSNFGTGTGL------CGATIITNNFLLTAAHCVVGGNGQ--------------VAIG 115

  Fly   177 ELDYNSTTDDALVQD------FRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVC 235
            ........|..:|:.      |......|||.|:...    .:||||.|.|:..|.||..|..:.
Mosquito   116 GTAILGAHDRTVVEPTQQRIAFAQSGIFVHPSYNPST----IRNDIATVRLNTPATFNARVQPID 176

  Fly   236 LPPDSGNDVQ-----QVTAAGWGFTADG--VKSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQFCA 293
            ||..|  |.:     :.||:|:|.|:|.  ..|..::.......|:..|......::......|.
Mosquito   177 LPARS--DARTFAGVEGTASGFGRTSDASTATSPVVMFTRNPILSNAQCNSFWSTAVVQAQNVCL 239

  Fly   294 GSMSSQADTCNGDSGGPIFVQ---HPLYPCLKQVIGIVSYGLVCG-SQGLPSVYTKVHLYTDWIE 354
            .:...:: .||||||||:.||   ..|      .:||.|:....| :.|.|||:.::..:.|||:
Mosquito   240 DATGGRS-PCNGDSGGPLAVQDGGRSL------EVGIASFVSAAGCASGAPSVWVRISFFRDWIQ 297

  Fly   355  354
            Mosquito   298  297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 72/271 (27%)
Tryp_SPc 102..353 CDD:214473 70/268 (26%)
AgaP_AGAP006674XP_316711.4 Tryp_SPc 59..296 CDD:214473 70/270 (26%)
Tryp_SPc 60..299 CDD:238113 72/271 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.